| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11432 | g11432.t36 | TTS | g11432.t36 | 16197707 | 16197707 |
| chr_1 | g11432 | g11432.t36 | isoform | g11432.t36 | 16197920 | 16200849 |
| chr_1 | g11432 | g11432.t36 | exon | g11432.t36.exon1 | 16197920 | 16197948 |
| chr_1 | g11432 | g11432.t36 | cds | g11432.t36.CDS1 | 16197920 | 16197948 |
| chr_1 | g11432 | g11432.t36 | exon | g11432.t36.exon2 | 16198111 | 16198353 |
| chr_1 | g11432 | g11432.t36 | cds | g11432.t36.CDS2 | 16198111 | 16198353 |
| chr_1 | g11432 | g11432.t36 | exon | g11432.t36.exon3 | 16199164 | 16199299 |
| chr_1 | g11432 | g11432.t36 | cds | g11432.t36.CDS3 | 16199164 | 16199299 |
| chr_1 | g11432 | g11432.t36 | exon | g11432.t36.exon4 | 16200826 | 16200849 |
| chr_1 | g11432 | g11432.t36 | cds | g11432.t36.CDS4 | 16200826 | 16200849 |
| chr_1 | g11432 | g11432.t36 | TSS | g11432.t36 | 16201105 | 16201105 |
>g11432.t36 Gene=g11432 Length=432
ATGGTAATTATCTCACATTATTTTGAAGCATTCTCATTGTTCGACAAAGACGGTGATGGC
ACAATTACCACAAAAGAATTGGGCACTGTGATGAGATCACTTGGTCAAAACCCGACAGAA
GCTGAACTTCAGGATATGATTAACGAAGTTGATGCTGACGGCAATGGTACCATAGATTTC
CCTGAATTCTTAACTATGATGGCTCGCAAAATGAAAGATACTGATAGTGAAGAAGAAATT
CGGGAAGCATTCCGTGTATTTGATAAAGATGGCAATGGTTTCATCTCTGCAGCTGAATTG
CGCCACGTGATGACAAATTTGGGAGAAAAATTAACAGATGAAGAAGTCGATGAAATGATT
CGTGAGGCAGATATTGATGGTGACGGACAAGTTAATTACGAAGAATTTGTCACCATGATG
ACATCAAAGTGA
>g11432.t36 Gene=g11432 Length=143
MVIISHYFEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF
PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI
READIDGDGQVNYEEFVTMMTSK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g11432.t36 | CDD | cd00051 | EFh | 9 | 68 | 6.00096E-21 |
| 11 | g11432.t36 | CDD | cd00051 | EFh | 79 | 141 | 6.14148E-24 |
| 8 | g11432.t36 | Gene3D | G3DSA:1.10.238.10 | - | 5 | 32 | 5.1E-8 |
| 7 | g11432.t36 | Gene3D | G3DSA:1.10.238.10 | - | 33 | 67 | 2.9E-20 |
| 6 | g11432.t36 | Gene3D | G3DSA:1.10.238.10 | - | 68 | 117 | 9.4E-28 |
| 9 | g11432.t36 | Gene3D | G3DSA:1.10.238.10 | - | 118 | 143 | 3.1E-7 |
| 3 | g11432.t36 | PANTHER | PTHR23050:SF401 | CALMODULIN | 4 | 143 | 5.5E-89 |
| 4 | g11432.t36 | PANTHER | PTHR23050 | CALCIUM BINDING PROTEIN | 4 | 143 | 5.5E-89 |
| 2 | g11432.t36 | Pfam | PF13499 | EF-hand domain pair | 7 | 67 | 2.1E-15 |
| 1 | g11432.t36 | Pfam | PF13499 | EF-hand domain pair | 77 | 140 | 7.1E-19 |
| 14 | g11432.t36 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 15 | 27 | - |
| 12 | g11432.t36 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 51 | 63 | - |
| 13 | g11432.t36 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 88 | 100 | - |
| 15 | g11432.t36 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 124 | 136 | - |
| 23 | g11432.t36 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 2 | 37 | 14.848 |
| 20 | g11432.t36 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 38 | 73 | 14.792 |
| 21 | g11432.t36 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 75 | 110 | 17.972 |
| 22 | g11432.t36 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 111 | 143 | 15.155 |
| 18 | g11432.t36 | SMART | SM00054 | efh_1 | 6 | 34 | 4.6E-6 |
| 16 | g11432.t36 | SMART | SM00054 | efh_1 | 42 | 70 | 7.2E-9 |
| 19 | g11432.t36 | SMART | SM00054 | efh_1 | 79 | 107 | 5.8E-9 |
| 17 | g11432.t36 | SMART | SM00054 | efh_1 | 115 | 143 | 1.3E-9 |
| 5 | g11432.t36 | SUPERFAMILY | SSF47473 | EF-hand | 5 | 142 | 7.0E-55 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005509 | calcium ion binding | MF |
| GO:0019722 | calcium-mediated signaling | BP |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed