Gene loci information

Transcript annotation

  • This transcript has been annotated as Calmodulin.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g11432 g11432.t42 TTS g11432.t42 16197707 16197707
chr_1 g11432 g11432.t42 isoform g11432.t42 16197920 16200849
chr_1 g11432 g11432.t42 exon g11432.t42.exon1 16197920 16197940
chr_1 g11432 g11432.t42 cds g11432.t42.CDS1 16197934 16197940
chr_1 g11432 g11432.t42 exon g11432.t42.exon2 16198107 16198353
chr_1 g11432 g11432.t42 cds g11432.t42.CDS2 16198107 16198353
chr_1 g11432 g11432.t42 exon g11432.t42.exon3 16199164 16199299
chr_1 g11432 g11432.t42 cds g11432.t42.CDS3 16199164 16199299
chr_1 g11432 g11432.t42 exon g11432.t42.exon4 16199438 16199476
chr_1 g11432 g11432.t42 cds g11432.t42.CDS4 16199438 16199476
chr_1 g11432 g11432.t42 exon g11432.t42.exon5 16200847 16200849
chr_1 g11432 g11432.t42 cds g11432.t42.CDS5 16200847 16200849
chr_1 g11432 g11432.t42 TSS g11432.t42 16201105 16201105

Sequences

>g11432.t42 Gene=g11432 Length=446
ATGGCTGATCAATTAACAGAGGAGCAAATCGCTGAGTTCAAAGAAGCATTCTCATTGTTC
GACAAAGACGGTGATGGCACAATTACCACAAAAGAATTGGGCACTGTGATGAGATCACTT
GGTCAAAACCCGACAGAAGCTGAACTTCAGGATATGATTAACGAAGTTGATGCTGACGGC
AATGGTACCATAGATTTCCCTGAATTCTTAACTATGATGGCTCGCAAAATGAAAGATACT
GATAGTGAAGAAGAAATTCGGGAAGCATTCCGTGTATTTGATAAAGATGGCAATGGTTTC
ATCTCTGCAGCTGAATTGCGCCACGTGATGACAAATTTGGGAGAAAAATTAACAGATGAA
GAAGTCGATGAAATGATTCGTGAGGCAGATATTGATGGTGACGGACAAGTTAATTACGAA
GGTATACCATGATGACATCAAAGTGA

>g11432.t42 Gene=g11432 Length=143
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEGIP

Protein features from InterProScan

Transcript Database ID Name Start End E.value
9 g11432.t42 CDD cd00051 EFh 12 74 1.83136E-22
10 g11432.t42 CDD cd00051 EFh 85 140 5.74395E-20
7 g11432.t42 Gene3D G3DSA:1.10.238.10 - 1 50 3.3E-22
8 g11432.t42 Gene3D G3DSA:1.10.238.10 - 51 111 5.0E-30
6 g11432.t42 Gene3D G3DSA:1.10.238.10 - 112 141 1.0E-11
3 g11432.t42 PANTHER PTHR23050:SF401 CALMODULIN 3 140 4.9E-90
4 g11432.t42 PANTHER PTHR23050 CALCIUM BINDING PROTEIN 3 140 4.9E-90
2 g11432.t42 Pfam PF13499 EF-hand domain pair 12 73 1.1E-15
1 g11432.t42 Pfam PF13499 EF-hand domain pair 83 140 2.8E-15
13 g11432.t42 ProSitePatterns PS00018 EF-hand calcium-binding domain. 21 33 -
11 g11432.t42 ProSitePatterns PS00018 EF-hand calcium-binding domain. 57 69 -
12 g11432.t42 ProSitePatterns PS00018 EF-hand calcium-binding domain. 94 106 -
19 g11432.t42 ProSiteProfiles PS50222 EF-hand calcium-binding domain profile. 8 43 17.303
20 g11432.t42 ProSiteProfiles PS50222 EF-hand calcium-binding domain profile. 44 79 14.792
21 g11432.t42 ProSiteProfiles PS50222 EF-hand calcium-binding domain profile. 81 116 17.972
18 g11432.t42 ProSiteProfiles PS50222 EF-hand calcium-binding domain profile. 117 143 8.906
17 g11432.t42 SMART SM00054 efh_1 12 40 8.5E-9
16 g11432.t42 SMART SM00054 efh_1 48 76 7.2E-9
15 g11432.t42 SMART SM00054 efh_1 85 113 5.8E-9
14 g11432.t42 SMART SM00054 efh_1 121 142 9.7
5 g11432.t42 SUPERFAMILY SSF47473 EF-hand 2 141 1.09E-54

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005509 calcium ion binding MF
GO:0019722 calcium-mediated signaling BP

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed