| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11432 | g11432.t45 | TTS | g11432.t45 | 16197707 | 16197707 |
| chr_1 | g11432 | g11432.t45 | isoform | g11432.t45 | 16197920 | 16200849 |
| chr_1 | g11432 | g11432.t45 | exon | g11432.t45.exon1 | 16197920 | 16197948 |
| chr_1 | g11432 | g11432.t45 | cds | g11432.t45.CDS1 | 16197920 | 16197948 |
| chr_1 | g11432 | g11432.t45 | exon | g11432.t45.exon2 | 16198111 | 16198353 |
| chr_1 | g11432 | g11432.t45 | cds | g11432.t45.CDS2 | 16198111 | 16198353 |
| chr_1 | g11432 | g11432.t45 | exon | g11432.t45.exon3 | 16199164 | 16199299 |
| chr_1 | g11432 | g11432.t45 | cds | g11432.t45.CDS3 | 16199164 | 16199233 |
| chr_1 | g11432 | g11432.t45 | exon | g11432.t45.exon4 | 16200825 | 16200849 |
| chr_1 | g11432 | g11432.t45 | TSS | g11432.t45 | 16201105 | 16201105 |
>g11432.t45 Gene=g11432 Length=433
ATGGTAATTATCTCACATTATTTTTGAAGCATTCTCATTGTTCGACAAAGACGGTGATGG
CACAATTACCACAAAAGAATTGGGCACTGTGATGAGATCACTTGGTCAAAACCCGACAGA
AGCTGAACTTCAGGATATGATTAACGAAGTTGATGCTGACGGCAATGGTACCATAGATTT
CCCTGAATTCTTAACTATGATGGCTCGCAAAATGAAAGATACTGATAGTGAAGAAGAAAT
TCGGGAAGCATTCCGTGTATTTGATAAAGATGGCAATGGTTTCATCTCTGCAGCTGAATT
GCGCCACGTGATGACAAATTTGGGAGAAAAATTAACAGATGAAGAAGTCGATGAAATGAT
TCGTGAGGCAGATATTGATGGTGACGGACAAGTTAATTACGAAGAATTTGTCACCATGAT
GACATCAAAGTGA
>g11432.t45 Gene=g11432 Length=113
MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD
GNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g11432.t45 | CDD | cd00051 | EFh | 12 | 75 | 7.14125E-12 |
| 9 | g11432.t45 | CDD | cd00051 | EFh | 49 | 111 | 7.33387E-24 |
| 6 | g11432.t45 | Gene3D | G3DSA:1.10.238.10 | - | 1 | 74 | 1.7E-51 |
| 7 | g11432.t45 | Gene3D | G3DSA:1.10.238.10 | - | 75 | 111 | 1.5E-17 |
| 3 | g11432.t45 | PANTHER | PTHR23050:SF401 | CALMODULIN | 1 | 113 | 7.9E-73 |
| 4 | g11432.t45 | PANTHER | PTHR23050 | CALCIUM BINDING PROTEIN | 1 | 113 | 7.9E-73 |
| 2 | g11432.t45 | Pfam | PF00036 | EF hand | 12 | 39 | 6.2E-9 |
| 1 | g11432.t45 | Pfam | PF13499 | EF-hand domain pair | 47 | 110 | 3.9E-19 |
| 12 | g11432.t45 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 21 | 33 | - |
| 10 | g11432.t45 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 58 | 70 | - |
| 11 | g11432.t45 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 94 | 106 | - |
| 16 | g11432.t45 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 8 | 43 | 14.792 |
| 18 | g11432.t45 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 45 | 80 | 17.972 |
| 17 | g11432.t45 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 81 | 113 | 15.155 |
| 15 | g11432.t45 | SMART | SM00054 | efh_1 | 12 | 40 | 7.2E-9 |
| 14 | g11432.t45 | SMART | SM00054 | efh_1 | 49 | 77 | 5.8E-9 |
| 13 | g11432.t45 | SMART | SM00054 | efh_1 | 85 | 113 | 1.3E-9 |
| 5 | g11432.t45 | SUPERFAMILY | SSF47473 | EF-hand | 1 | 112 | 5.71E-44 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005509 | calcium ion binding | MF |
| GO:0019722 | calcium-mediated signaling | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed