| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11432 | g11432.t47 | TTS | g11432.t47 | 16197707 | 16197707 |
| chr_1 | g11432 | g11432.t47 | isoform | g11432.t47 | 16197920 | 16200849 |
| chr_1 | g11432 | g11432.t47 | exon | g11432.t47.exon1 | 16197920 | 16197948 |
| chr_1 | g11432 | g11432.t47 | cds | g11432.t47.CDS1 | 16197934 | 16197948 |
| chr_1 | g11432 | g11432.t47 | exon | g11432.t47.exon2 | 16198124 | 16198353 |
| chr_1 | g11432 | g11432.t47 | cds | g11432.t47.CDS2 | 16198124 | 16198353 |
| chr_1 | g11432 | g11432.t47 | exon | g11432.t47.exon3 | 16199164 | 16199299 |
| chr_1 | g11432 | g11432.t47 | cds | g11432.t47.CDS3 | 16199164 | 16199299 |
| chr_1 | g11432 | g11432.t47 | exon | g11432.t47.exon4 | 16199438 | 16199476 |
| chr_1 | g11432 | g11432.t47 | cds | g11432.t47.CDS4 | 16199438 | 16199476 |
| chr_1 | g11432 | g11432.t47 | exon | g11432.t47.exon5 | 16200847 | 16200849 |
| chr_1 | g11432 | g11432.t47 | cds | g11432.t47.CDS5 | 16200847 | 16200849 |
| chr_1 | g11432 | g11432.t47 | TSS | g11432.t47 | 16201105 | 16201105 |
>g11432.t47 Gene=g11432 Length=437
ATGGCTGATCAATTAACAGAGGAGCAAATCGCTGAGTTCAAAGAAGCATTCTCATTGTTC
GACAAAGACGGTGATGGCACAATTACCACAAAAGAATTGGGCACTGTGATGAGATCACTT
GGTCAAAACCCGACAGAAGCTGAACTTCAGGATATGATTAACGAAGTTGATGCTGACGGC
AATGGTACCATAGATTTCCCTGAATTCTTAACTATGATGGCTCGCAAAATGAAAGATACT
GATAGTGAAGAAGAAATTCGGGAAGCATTCCGTGTATTTGATAAAGATGGCAATGGTTTC
ATCTCTGCAGCTGAATTGCGCCACGTGATGACAAATTTGGGAGAAAAATTAACAGATGAA
GAAGTCGATGAAATGATTCGTGAGGCAGATATTGATGGTGACGGACAAAATTTGTCACCA
TGATGACATCAAAGTGA
>g11432.t47 Gene=g11432 Length=140
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQNLSP
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 13 | g11432.t47 | CDD | cd00051 | EFh | 12 | 74 | 2.38185E-22 |
| 12 | g11432.t47 | CDD | cd00051 | EFh | 85 | 136 | 4.57733E-18 |
| 10 | g11432.t47 | Gene3D | G3DSA:1.10.238.10 | - | 1 | 50 | 3.1E-22 |
| 9 | g11432.t47 | Gene3D | G3DSA:1.10.238.10 | - | 51 | 110 | 4.8E-30 |
| 11 | g11432.t47 | Gene3D | G3DSA:1.10.238.10 | - | 111 | 136 | 2.4E-9 |
| 3 | g11432.t47 | PANTHER | PTHR23050:SF401 | CALMODULIN | 3 | 136 | 1.1E-86 |
| 4 | g11432.t47 | PANTHER | PTHR23050 | CALCIUM BINDING PROTEIN | 3 | 136 | 1.1E-86 |
| 6 | g11432.t47 | PRINTS | PR00450 | Recoverin family signature | 5 | 24 | 9.8E-5 |
| 5 | g11432.t47 | PRINTS | PR00450 | Recoverin family signature | 52 | 73 | 9.8E-5 |
| 7 | g11432.t47 | PRINTS | PR00450 | Recoverin family signature | 99 | 117 | 9.8E-5 |
| 2 | g11432.t47 | Pfam | PF13499 | EF-hand domain pair | 12 | 73 | 1.1E-15 |
| 1 | g11432.t47 | Pfam | PF13499 | EF-hand domain pair | 83 | 136 | 2.7E-13 |
| 16 | g11432.t47 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 21 | 33 | - |
| 14 | g11432.t47 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 57 | 69 | - |
| 15 | g11432.t47 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 94 | 106 | - |
| 20 | g11432.t47 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 8 | 43 | 17.303 |
| 22 | g11432.t47 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 44 | 79 | 14.792 |
| 23 | g11432.t47 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 81 | 116 | 17.972 |
| 21 | g11432.t47 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 117 | 140 | 9.576 |
| 19 | g11432.t47 | SMART | SM00054 | efh_1 | 12 | 40 | 8.5E-9 |
| 18 | g11432.t47 | SMART | SM00054 | efh_1 | 48 | 76 | 7.2E-9 |
| 17 | g11432.t47 | SMART | SM00054 | efh_1 | 85 | 113 | 5.8E-9 |
| 8 | g11432.t47 | SUPERFAMILY | SSF47473 | EF-hand | 2 | 136 | 2.62E-52 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005509 | calcium ion binding | MF |
| GO:0019722 | calcium-mediated signaling | BP |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed