| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11432 | g11432.t49 | TTS | g11432.t49 | 16197707 | 16197707 |
| chr_1 | g11432 | g11432.t49 | isoform | g11432.t49 | 16197920 | 16200849 |
| chr_1 | g11432 | g11432.t49 | exon | g11432.t49.exon1 | 16197920 | 16197935 |
| chr_1 | g11432 | g11432.t49 | cds | g11432.t49.CDS1 | 16197920 | 16197935 |
| chr_1 | g11432 | g11432.t49 | exon | g11432.t49.exon2 | 16198107 | 16198353 |
| chr_1 | g11432 | g11432.t49 | cds | g11432.t49.CDS2 | 16198107 | 16198353 |
| chr_1 | g11432 | g11432.t49 | exon | g11432.t49.exon3 | 16199164 | 16199299 |
| chr_1 | g11432 | g11432.t49 | cds | g11432.t49.CDS3 | 16199164 | 16199299 |
| chr_1 | g11432 | g11432.t49 | exon | g11432.t49.exon4 | 16200847 | 16200849 |
| chr_1 | g11432 | g11432.t49 | cds | g11432.t49.CDS4 | 16200847 | 16200849 |
| chr_1 | g11432 | g11432.t49 | TSS | g11432.t49 | 16201105 | 16201105 |
>g11432.t49 Gene=g11432 Length=402
ATGGAAGCATTCTCATTGTTCGACAAAGACGGTGATGGCACAATTACCACAAAAGAATTG
GGCACTGTGATGAGATCACTTGGTCAAAACCCGACAGAAGCTGAACTTCAGGATATGATT
AACGAAGTTGATGCTGACGGCAATGGTACCATAGATTTCCCTGAATTCTTAACTATGATG
GCTCGCAAAATGAAAGATACTGATAGTGAAGAAGAAATTCGGGAAGCATTCCGTGTATTT
GATAAAGATGGCAATGGTTTCATCTCTGCAGCTGAATTGCGCCACGTGATGACAAATTTG
GGAGAAAAATTAACAGATGAAGAAGTCGATGAAATGATTCGTGAGGCAGATATTGATGGT
GACGGACAAGTTAATTACGAAGGTATGATGACATCAAAGTGA
>g11432.t49 Gene=g11432 Length=133
MEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMM
ARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDG
DGQVNYEGMMTSK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g11432.t49 | CDD | cd00051 | EFh | 1 | 61 | 8.56807E-21 |
| 9 | g11432.t49 | CDD | cd00051 | EFh | 72 | 127 | 8.14468E-20 |
| 7 | g11432.t49 | Gene3D | G3DSA:1.10.238.10 | - | 2 | 97 | 1.8E-68 |
| 6 | g11432.t49 | Gene3D | G3DSA:1.10.238.10 | - | 98 | 131 | 1.1E-11 |
| 3 | g11432.t49 | PANTHER | PTHR23050:SF401 | CALMODULIN | 2 | 131 | 1.0E-82 |
| 4 | g11432.t49 | PANTHER | PTHR23050 | CALCIUM BINDING PROTEIN | 2 | 131 | 1.0E-82 |
| 2 | g11432.t49 | Pfam | PF13499 | EF-hand domain pair | 1 | 60 | 3.1E-15 |
| 1 | g11432.t49 | Pfam | PF13499 | EF-hand domain pair | 70 | 129 | 9.8E-16 |
| 10 | g11432.t49 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 8 | 20 | - |
| 12 | g11432.t49 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 44 | 56 | - |
| 11 | g11432.t49 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 81 | 93 | - |
| 17 | g11432.t49 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 1 | 30 | 15.322 |
| 18 | g11432.t49 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 31 | 66 | 14.792 |
| 20 | g11432.t49 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 68 | 103 | 17.972 |
| 19 | g11432.t49 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 104 | 133 | 8.627 |
| 13 | g11432.t49 | SMART | SM00054 | efh_1 | 1 | 27 | 2.8E-4 |
| 16 | g11432.t49 | SMART | SM00054 | efh_1 | 35 | 63 | 7.2E-9 |
| 15 | g11432.t49 | SMART | SM00054 | efh_1 | 72 | 100 | 5.8E-9 |
| 14 | g11432.t49 | SMART | SM00054 | efh_1 | 108 | 133 | 0.13 |
| 5 | g11432.t49 | SUPERFAMILY | SSF47473 | EF-hand | 2 | 130 | 1.66E-50 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005509 | calcium ion binding | MF |
| GO:0019722 | calcium-mediated signaling | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed