General information for g11456.t83
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Hsp90 co-chaperone Cdc37.
Parent gene
- The parent gene g11456 is located on chr_1: 16359059..16361209 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11456 | g11456.t83 | TTS | g11456.t83 | 16358079 | 16358079 |
| chr_1 | g11456 | g11456.t83 | isoform | g11456.t83 | 16358239 | 16358891 |
| chr_1 | g11456 | g11456.t83 | exon | g11456.t83.exon1 | 16358239 | 16358442 |
| chr_1 | g11456 | g11456.t83 | cds | g11456.t83.CDS1 | 16358239 | 16358442 |
| chr_1 | g11456 | g11456.t83 | exon | g11456.t83.exon2 | 16358577 | 16358891 |
| chr_1 | g11456 | g11456.t83 | cds | g11456.t83.CDS2 | 16358577 | 16358879 |
| chr_1 | g11456 | g11456.t83 | TSS | g11456.t83 | 16359617 | 16359617 |
Sequences
>g11456.t83 Gene=g11456 Length=519
AAGCATGAACTGATGACACATGTTGCTCATCAATGCATTTGTATGCAATACATGCTTGAA
CTTTCTAAACAACTTAAAATTGATCCTCGAGCATGTATTGCTCCATTTTTTGAGAGAATT
CAAACTGCTGATGTTGAGTACAAACGTCAATTTGAAGATGAAATTGCTGCATTTATCGGT
CGTATTGAGAGACGAGCAAAGGAGAAAATTGCAGAAGCTCTTAAAGAACAAGAGGAAGAA
GAAAAACGCGAGAGACTTGCACGACTTGGACCTGGCGGTTTGGATCCAGCTGAAGTTTTT
GAAACATTGCCCAAGAAGGATCTTCAAGTTTGTTTTGAAACTCGTGATACAGAAATGCTA
AAGGAAGTAATTTCAAAAATGCCAGAAGATGAAGCAAAATATCACATGAAGCGTTGTGTA
GATTCTGGTTTATGGGTACCTGATGCAAGTCAACTACCATCATCTGAAAATGAGGAAGAA
AATAAAACAACTCAAAACAACGATTTGGATTTGGATTAA
>g11456.t83 Gene=g11456 Length=168
MTHVAHQCICMQYMLELSKQLKIDPRACIAPFFERIQTADVEYKRQFEDEIAAFIGRIER
RAKEKIAEALKEQEEEEKRERLARLGPGGLDPAEVFETLPKKDLQVCFETRDTEMLKEVI
SKMPEDEAKYHMKRCVDSGLWVPDASQLPSSENEEENKTTQNNDLDLD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g11456.t83 | Coils | Coil | Coil | 59 | 83 | - |
| 9 | g11456.t83 | Gene3D | G3DSA:1.20.58.610 | - | 1 | 71 | 7.7E-29 |
| 8 | g11456.t83 | MobiDBLite | mobidb-lite | consensus disorder prediction | 143 | 168 | - |
| 3 | g11456.t83 | PANTHER | PTHR12800:SF3 | HSP90 CO-CHAPERONE CDC37 | 1 | 159 | 1.2E-54 |
| 4 | g11456.t83 | PANTHER | PTHR12800 | CDC37-RELATED | 1 | 159 | 1.2E-54 |
| 1 | g11456.t83 | Pfam | PF08565 | Cdc37 Hsp90 binding domain | 2 | 68 | 5.5E-11 |
| 2 | g11456.t83 | Pfam | PF08564 | Cdc37 C terminal domain | 89 | 160 | 2.4E-13 |
| 7 | g11456.t83 | SMART | SM01070 | CDC37_M_2 | 1 | 77 | 3.1E-4 |
| 6 | g11456.t83 | SMART | SM01069 | CDC37_C_2 | 84 | 159 | 7.7E-29 |
| 5 | g11456.t83 | SUPERFAMILY | SSF101391 | Hsp90 co-chaperone CDC37 | 1 | 145 | 1.96E-45 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
