| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11457 | g11457.t13 | TSS | g11457.t13 | 16359741 | 16359741 |
| chr_1 | g11457 | g11457.t13 | isoform | g11457.t13 | 16359850 | 16361615 |
| chr_1 | g11457 | g11457.t13 | exon | g11457.t13.exon1 | 16359850 | 16359928 |
| chr_1 | g11457 | g11457.t13 | cds | g11457.t13.CDS1 | 16359878 | 16359928 |
| chr_1 | g11457 | g11457.t13 | exon | g11457.t13.exon2 | 16360148 | 16360266 |
| chr_1 | g11457 | g11457.t13 | cds | g11457.t13.CDS2 | 16360148 | 16360266 |
| chr_1 | g11457 | g11457.t13 | exon | g11457.t13.exon3 | 16360771 | 16361615 |
| chr_1 | g11457 | g11457.t13 | cds | g11457.t13.CDS3 | 16360771 | 16360975 |
| chr_1 | g11457 | g11457.t13 | TTS | g11457.t13 | 16361611 | 16361611 |
>g11457.t13 Gene=g11457 Length=1043
ATGGCATTACCAGAAGAAGCACCAATTTATGGACCATTTTTTGGAGTTATGGGAGCAGCA
GCTGCCATTATTTTCAGCGTTGATTATGAAATCAATTATTCCCGTTGTTATGGCAGGTAT
TATTGCTATTTATGGACTTGTAGTTGCTGTTCTTATTGCTGGAGCCCTCGAAGAACCACC
AAAATACACTCTTTACAAAGCCTTCATTCATCTCGGTGCTGGACTTGCTGTAGGATTCTC
AGGCTTAGCTGCAGGTTTCGCCATTGGAATTGTTGGTGATGCCGGTGTAAGAGGAACAAC
TCAACAACCAAGACTCTTCGTTGGTATGATTTTAATTCTGATCTTTGCTGAAGTTTTGGG
TCTTTATGGCTTGATTGTTGCCATTTACTTGTATACCAAATAAATTTTCTTTTTTCGCTT
TTACTCTAAGTTACGATTATTTATATTCAAATATAAGATTCCTTTACATTTTTCATTCAC
TCAAAACTTGCATTAAATATTAATGATGATGTGATATTAATATATCCTACCTTCAATAAC
ATCAAACATGAGACAACTAAAATTGCACATGACTTACAAAAATTGGTCATATGAGAAAAG
AAAAAAATTTTGAAAGAAAAATTGTAAAGTGAATCACAGTGTTTCGGTGAACAAAAAAGA
AAATTTTATAGAATGAACGCACGTGAGAGAGAAAGACGTATCAAGCCAAAATTTACAATA
TTTACAAATTGATGCTGTTTTTAAATAATTGTAAACCATATTGATACGACTGAATTAGTT
CTATTAAATTTTCTTTTTTCAATAAAAAATTAAAATCAATCATTTTTTTGAATCACGTGT
AACCGATTAGTTACTATCATTCAATTGCTAATATCCATATTAAAATTACATAAAAATAAA
TTTTATTAAAGGAAAGAAAAGAAAACTTATTAAGTACATCATTCATAATGAGAACATTGT
TGTTGTATCAATTGAAAATATCATTAAAAACTGCTCTAGAATAATACAGTGCACATAAAA
TAAAAGTAATTTTTAAGATAGTT
>g11457.t13 Gene=g11457 Length=124
MDHFLELWEQQLPLFSALIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPPKYTLYKAFI
HLGAGLAVGFSGLAAGFAIGIVGDAGVRGTTQQPRLFVGMILILIFAEVLGLYGLIVAIY
LYTK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 17 | g11457.t13 | CDD | cd18176 | ATP-synt_Vo_c_ATP6C_rpt2 | 55 | 122 | 1.25697E-31 |
| 9 | g11457.t13 | Gene3D | G3DSA:1.20.120.610 | - | 14 | 124 | 6.1E-42 |
| 3 | g11457.t13 | PANTHER | PTHR10263 | V-TYPE PROTON ATPASE PROTEOLIPID SUBUNIT | 17 | 124 | 5.5E-51 |
| 4 | g11457.t13 | PANTHER | PTHR10263:SF5 | V-TYPE PROTON ATPASE 16 KDA PROTEOLIPID SUBUNIT | 17 | 124 | 5.5E-51 |
| 5 | g11457.t13 | PRINTS | PR00122 | Vacuolar ATP synthase 16kDa subunit signature | 23 | 47 | 1.1E-42 |
| 6 | g11457.t13 | PRINTS | PR00122 | Vacuolar ATP synthase 16kDa subunit signature | 73 | 99 | 1.1E-42 |
| 7 | g11457.t13 | PRINTS | PR00122 | Vacuolar ATP synthase 16kDa subunit signature | 100 | 123 | 1.1E-42 |
| 2 | g11457.t13 | Pfam | PF00137 | ATP synthase subunit C | 18 | 43 | 3.2E-6 |
| 1 | g11457.t13 | Pfam | PF00137 | ATP synthase subunit C | 62 | 121 | 3.4E-22 |
| 13 | g11457.t13 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 22 | - |
| 14 | g11457.t13 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 23 | 47 | - |
| 11 | g11457.t13 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 48 | 58 | - |
| 15 | g11457.t13 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 59 | 83 | - |
| 12 | g11457.t13 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 84 | 94 | - |
| 16 | g11457.t13 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 122 | - |
| 10 | g11457.t13 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 123 | 124 | - |
| 8 | g11457.t13 | SUPERFAMILY | SSF81333 | F1F0 ATP synthase subunit C | 53 | 123 | 1.7E-20 |
| 21 | g11457.t13 | TIGRFAM | TIGR01100 | V_ATP_synt_C: V-type ATPase, C subunit | 17 | 87 | 1.0E-32 |
| 19 | g11457.t13 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 23 | 45 | - |
| 20 | g11457.t13 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 58 | 80 | - |
| 18 | g11457.t13 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 100 | 122 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0033179 | proton-transporting V-type ATPase, V0 domain | CC |
| GO:1902600 | proton transmembrane transport | BP |
| GO:0033177 | proton-transporting two-sector ATPase complex, proton-transporting domain | CC |
| GO:0015078 | proton transmembrane transporter activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed