| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11466 | g11466.t66 | isoform | g11466.t66 | 16400653 | 16403493 |
| chr_1 | g11466 | g11466.t66 | exon | g11466.t66.exon1 | 16400653 | 16400691 |
| chr_1 | g11466 | g11466.t66 | cds | g11466.t66.CDS1 | 16400653 | 16400691 |
| chr_1 | g11466 | g11466.t66 | exon | g11466.t66.exon2 | 16400819 | 16400894 |
| chr_1 | g11466 | g11466.t66 | cds | g11466.t66.CDS2 | 16400819 | 16400894 |
| chr_1 | g11466 | g11466.t66 | exon | g11466.t66.exon3 | 16401901 | 16401971 |
| chr_1 | g11466 | g11466.t66 | cds | g11466.t66.CDS3 | 16401901 | 16401971 |
| chr_1 | g11466 | g11466.t66 | exon | g11466.t66.exon4 | 16402845 | 16402962 |
| chr_1 | g11466 | g11466.t66 | cds | g11466.t66.CDS4 | 16402845 | 16402916 |
| chr_1 | g11466 | g11466.t66 | exon | g11466.t66.exon5 | 16403395 | 16403493 |
| chr_1 | g11466 | g11466.t66 | TSS | g11466.t66 | NA | NA |
| chr_1 | g11466 | g11466.t66 | TTS | g11466.t66 | NA | NA |
>g11466.t66 Gene=g11466 Length=403
TCAACTTTTGGAAGAAGACCTCGAACGTTCTGAAGAGCGTTTGGCATCTGCTACCGCAAA
GTTGTCAGAAGCATCAGCTGCTGCTGATGAATCTGAACGTGCCCGTAAAGTTCTTGAAAA
CCGTTCACTTGCCGATGAAGAGCGTATGGATGCTCTTGAAAATCAATTGAAGGAAGCTCG
CTTCCTCGCTGAAGAAGCTGACAAGAAATACGATGAGGTTGCACGTAAATTAGCTATGGT
TGAGGCTGATCTTGAACGTGCAGAAGAGCGTGCAGAAGCTGGTGAAGCCAAAATTGTTGA
ACTTGAAGAAGAACTTCGCGTCGTCGGTAACAACTTGAAGTCATTGGAAGTGTCAGAAGA
GAAGGCAAATCAACGTGAAGAAGAATATAAGAATCAAATTAAG
>g11466.t66 Gene=g11466 Length=86
MDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEAGEAKIVELEEELRVV
GNNLKSLEVSEEKANQREEEYKNQIK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g11466.t66 | Coils | Coil | Coil | 1 | 86 | - |
| 7 | g11466.t66 | Gene3D | G3DSA:1.20.5.340 | - | 20 | 86 | 2.6E-11 |
| 2 | g11466.t66 | PANTHER | PTHR19269:SF45 | TROPOMYOSIN-1, ISOFORMS 33/34 | 1 | 86 | 2.7E-40 |
| 3 | g11466.t66 | PANTHER | PTHR19269 | TROPOMYOSIN | 1 | 86 | 2.7E-40 |
| 5 | g11466.t66 | PRINTS | PR00194 | Tropomyosin signature | 5 | 33 | 1.7E-23 |
| 4 | g11466.t66 | PRINTS | PR00194 | Tropomyosin signature | 35 | 58 | 1.7E-23 |
| 1 | g11466.t66 | Pfam | PF00261 | Tropomyosin | 1 | 86 | 5.9E-35 |
| 6 | g11466.t66 | SUPERFAMILY | SSF57997 | Tropomyosin | 1 | 86 | 1.87E-28 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.