| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11466 | g11466.t74 | isoform | g11466.t74 | 16401951 | 16407076 |
| chr_1 | g11466 | g11466.t74 | exon | g11466.t74.exon1 | 16401951 | 16401971 |
| chr_1 | g11466 | g11466.t74 | cds | g11466.t74.CDS1 | 16401951 | 16401971 |
| chr_1 | g11466 | g11466.t74 | exon | g11466.t74.exon2 | 16402845 | 16402962 |
| chr_1 | g11466 | g11466.t74 | cds | g11466.t74.CDS2 | 16402845 | 16402962 |
| chr_1 | g11466 | g11466.t74 | exon | g11466.t74.exon3 | 16403395 | 16403528 |
| chr_1 | g11466 | g11466.t74 | cds | g11466.t74.CDS3 | 16403395 | 16403528 |
| chr_1 | g11466 | g11466.t74 | exon | g11466.t74.exon4 | 16406585 | 16406868 |
| chr_1 | g11466 | g11466.t74 | cds | g11466.t74.CDS4 | 16406585 | 16406824 |
| chr_1 | g11466 | g11466.t74 | exon | g11466.t74.exon5 | 16407017 | 16407076 |
| chr_1 | g11466 | g11466.t74 | TSS | g11466.t74 | 16407060 | 16407060 |
| chr_1 | g11466 | g11466.t74 | TTS | g11466.t74 | NA | NA |
>g11466.t74 Gene=g11466 Length=617
AGTAAAGTTTTTCTTCAGTTCGCCATCAAAACTGTTCAAGTCGCGGATTCAGATTCAAGT
TCTCTGGTGCTTTCGTAATACCGTAGTAAAAACACATTACCAAAATGGATGCGATTAAGA
AAAAAATGCAAGCAATGAAGCTTGAGAAGGATAACGCATTAGATCGCGCCCTTCTCTGTG
AACAGCAAGCTCGTGATGCAAACACACGTGCTGAAAAGGCCGAAGAAGAGGCCCGCACAT
TGCAAAAGAAGATCCAAACAATTGAAAATGATTTGGATCAGACACAAGAACAAGAGACTC
TTGTTAATGGAAAGCTTGAAGAAAAAGAAAAGGCACTTCAAAATGCTGAATCAGAAGTCG
CTGCTTTGAACCGTCGTATTCAACTTTTGGAAGAAGACCTCGAACGTTCTGAAGAGCGTT
TGGCATCTGCTACCGCAAAGTTGTCAGAAGCATCAGCTGCTGCTGATGAATCTGAACGTG
CCCGTAAAGTTCTTGAAAACCGTTCACTTGCCGATGAAGAGCGTATGGATGCTCTTGAAA
ATCAATTGAAGGAAGCTCGCTTCCTCGCTGAAGAAGCTGACAAGAAATACGATGAGGTTG
CACGTAAATTAGCTATG
>g11466.t74 Gene=g11466 Length=171
MDAIKKKMQAMKLEKDNALDRALLCEQQARDANTRAEKAEEEARTLQKKIQTIENDLDQT
QEQETLVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA
DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAM
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g11466.t74 | Coils | Coil | Coil | 1 | 168 | - |
| 10 | g11466.t74 | Gene3D | G3DSA:1.20.5.340 | - | 1 | 95 | 2.5E-36 |
| 9 | g11466.t74 | Gene3D | G3DSA:1.20.5.340 | - | 96 | 139 | 6.5E-6 |
| 8 | g11466.t74 | MobiDBLite | mobidb-lite | consensus disorder prediction | 109 | 134 | - |
| 7 | g11466.t74 | MobiDBLite | mobidb-lite | consensus disorder prediction | 118 | 134 | - |
| 2 | g11466.t74 | PANTHER | PTHR19269 | TROPOMYOSIN | 1 | 171 | 4.2E-60 |
| 3 | g11466.t74 | PRINTS | PR00194 | Tropomyosin signature | 84 | 101 | 1.9E-30 |
| 5 | g11466.t74 | PRINTS | PR00194 | Tropomyosin signature | 120 | 140 | 1.9E-30 |
| 4 | g11466.t74 | PRINTS | PR00194 | Tropomyosin signature | 145 | 171 | 1.9E-30 |
| 1 | g11466.t74 | Pfam | PF00261 | Tropomyosin | 48 | 171 | 2.9E-43 |
| 6 | g11466.t74 | SUPERFAMILY | SSF57997 | Tropomyosin | 1 | 171 | 1.12E-54 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed