| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11473 | g11473.t4 | isoform | g11473.t4 | 16434579 | 16435368 |
| chr_1 | g11473 | g11473.t4 | exon | g11473.t4.exon1 | 16434579 | 16434589 |
| chr_1 | g11473 | g11473.t4 | cds | g11473.t4.CDS1 | 16434579 | 16434589 |
| chr_1 | g11473 | g11473.t4 | exon | g11473.t4.exon2 | 16434654 | 16434846 |
| chr_1 | g11473 | g11473.t4 | cds | g11473.t4.CDS2 | 16434654 | 16434846 |
| chr_1 | g11473 | g11473.t4 | exon | g11473.t4.exon3 | 16434917 | 16435368 |
| chr_1 | g11473 | g11473.t4 | cds | g11473.t4.CDS3 | 16434917 | 16435345 |
| chr_1 | g11473 | g11473.t4 | TSS | g11473.t4 | NA | NA |
| chr_1 | g11473 | g11473.t4 | TTS | g11473.t4 | NA | NA |
>g11473.t4 Gene=g11473 Length=656
ATCGATCAATTGCGGTTTGGGATATGACTTCGCCTAAAGAAATAACTTTGCGTAGAGTGC
TTGTTGGGCATAGAGCTGCTGTTAATGTTGTAGACTTTGACGAAAAATATATTGTATCAG
CATCTGGAGACAGAACCATTAAAGTTTGGAGCACTTCTTCATGTGAATTTATTAGGACAT
TAAATGGTCATAAACGAGGAATAGCTTGTCTTCAATATCGTGACAGATTGGTTGTTAGTG
GAAGTTCTGATAATTCAATTCGTTTATGGGATATTGAATGTGGTGCATGTCTACGCGTTT
TAGAAGGACACGAAGAGCTAGTTCGTTGCATTCGATTTGATTCAAAGAGGATAGTGTCTG
GAGCCTATGATGGTAAGATTAAAGTTTGGGATTTAGTTGCTGCATTAGATCCTCGGGCTC
AACCATCATCATTATGTATTAAAACACTAAATGAACACACAGGACGAGTTTTTAGACTTC
AATTTGACGAATTCCAAATCGTAAGCAGCTCTCATGATGATACGATTTTAATATGGGATT
TCCTAAATTATTCACAAGAAAATAATGCCGATCCTGGGCCAAATCGCAACAATAACACCT
TAACGATGACGACTGCAAATAATGAAAGTGGAAGAAGTCCATCCCCTATGGAATAA
>g11473.t4 Gene=g11473 Length=210
MTSPKEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFIRTLNGHKRGI
ACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDSKRIVSGAYDGKIK
VWDLVAALDPRAQPSSLCIKTLNEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLNYSQEN
NADPGPNRNNNTLTMTTANNESGRSPSPME
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g11473.t4 | CDD | cd00200 | WD40 | 9 | 173 | 6.89425E-46 |
| 11 | g11473.t4 | Gene3D | G3DSA:2.130.10.10 | - | 1 | 171 | 2.1E-61 |
| 20 | g11473.t4 | MobiDBLite | mobidb-lite | consensus disorder prediction | 182 | 210 | - |
| 5 | g11473.t4 | PANTHER | PTHR19865:SF9 | F-BOX AND WD REPEAT DOMAIN-CONTAINING 11A | 9 | 185 | 6.1E-117 |
| 6 | g11473.t4 | PANTHER | PTHR19865 | U3 SMALL NUCLEOLAR RNA INTERACTING PROTEIN 2 | 9 | 185 | 6.1E-117 |
| 8 | g11473.t4 | PRINTS | PR00320 | G protein beta WD-40 repeat signature | 30 | 44 | 7.1E-10 |
| 9 | g11473.t4 | PRINTS | PR00320 | G protein beta WD-40 repeat signature | 70 | 84 | 7.1E-10 |
| 7 | g11473.t4 | PRINTS | PR00320 | G protein beta WD-40 repeat signature | 110 | 124 | 7.1E-10 |
| 4 | g11473.t4 | Pfam | PF00400 | WD domain, G-beta repeat | 10 | 43 | 5.8E-4 |
| 3 | g11473.t4 | Pfam | PF00400 | WD domain, G-beta repeat | 49 | 83 | 3.5E-5 |
| 1 | g11473.t4 | Pfam | PF00400 | WD domain, G-beta repeat | 87 | 123 | 1.4E-6 |
| 2 | g11473.t4 | Pfam | PF00400 | WD domain, G-beta repeat | 138 | 172 | 0.017 |
| 19 | g11473.t4 | ProSitePatterns | PS00678 | Trp-Asp (WD) repeats signature. | 70 | 84 | - |
| 17 | g11473.t4 | ProSitePatterns | PS00678 | Trp-Asp (WD) repeats signature. | 110 | 124 | - |
| 18 | g11473.t4 | ProSitePatterns | PS00678 | Trp-Asp (WD) repeats signature. | 159 | 173 | - |
| 21 | g11473.t4 | ProSiteProfiles | PS50294 | Trp-Asp (WD) repeats circular profile. | 13 | 181 | 35.989 |
| 25 | g11473.t4 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 13 | 52 | 13.148 |
| 24 | g11473.t4 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 53 | 92 | 13.717 |
| 22 | g11473.t4 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 93 | 124 | 13.115 |
| 23 | g11473.t4 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 142 | 172 | 10.174 |
| 14 | g11473.t4 | SMART | SM00320 | WD40_4 | 6 | 43 | 3.4E-6 |
| 16 | g11473.t4 | SMART | SM00320 | WD40_4 | 46 | 83 | 3.0E-6 |
| 15 | g11473.t4 | SMART | SM00320 | WD40_4 | 86 | 123 | 1.1E-6 |
| 13 | g11473.t4 | SMART | SM00320 | WD40_4 | 135 | 172 | 7.0E-5 |
| 10 | g11473.t4 | SUPERFAMILY | SSF50978 | WD40 repeat-like | 7 | 178 | 6.64E-49 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0034511 | U3 snoRNA binding | MF |
| GO:0005515 | protein binding | MF |
| GO:0006364 | rRNA processing | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.