General information for g115.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Acyl-CoA desaturase.
Parent gene
- The parent gene g115 is located on chr_3: 998511..1001365 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g115 | g115.t1 | TTS | g115.t1 | 996357 | 996357 |
| chr_3 | g115 | g115.t1 | isoform | g115.t1 | 996419 | 998969 |
| chr_3 | g115 | g115.t1 | exon | g115.t1.exon1 | 996419 | 996694 |
| chr_3 | g115 | g115.t1 | cds | g115.t1.CDS1 | 996419 | 996694 |
| chr_3 | g115 | g115.t1 | exon | g115.t1.exon2 | 996752 | 997010 |
| chr_3 | g115 | g115.t1 | cds | g115.t1.CDS2 | 996752 | 997010 |
| chr_3 | g115 | g115.t1 | exon | g115.t1.exon3 | 997069 | 997197 |
| chr_3 | g115 | g115.t1 | cds | g115.t1.CDS3 | 997069 | 997197 |
| chr_3 | g115 | g115.t1 | exon | g115.t1.exon4 | 997284 | 997360 |
| chr_3 | g115 | g115.t1 | cds | g115.t1.CDS4 | 997284 | 997360 |
| chr_3 | g115 | g115.t1 | exon | g115.t1.exon5 | 998503 | 998633 |
| chr_3 | g115 | g115.t1 | cds | g115.t1.CDS5 | 998503 | 998633 |
| chr_3 | g115 | g115.t1 | exon | g115.t1.exon6 | 998702 | 998969 |
| chr_3 | g115 | g115.t1 | cds | g115.t1.CDS6 | 998702 | 998969 |
| chr_3 | g115 | g115.t1 | TSS | g115.t1 | NA | NA |
Sequences
>g115.t1 Gene=g115 Length=1140
ATGGCACCAGAAATAATGCAACCATCAAATCAGTCACAAAATGATAAAAATATTATACAT
CGTGTAAGCACAAATAAATTAGATGACAATCACAATTACAATCATGCAAATGGAAATGGA
AAAGTCGAAGCAGAAAATTCTCATGAAGTATTTAAGCCAAAAATACGATGGCCAGATTTT
ATAGTGCAATTATCATTACATATTGGATTTTTGTATGGTCTCTATTACTTAATCGCACTA
AAAGCAAAATTCTACACATACATTTGGTTCTTTGTCCTCATTTATGTAACAGGTTTAGGT
ATTACAGCCGGTGCGCATCGTCTATGGAGTCATCGTTCATACAAAGCAAAACTTCCATTG
CGTGTCCTTCTTTTGATATTTTTCACAATTGCTGGACAGAGAGACGCATATACATGGGCA
CACGATCATCGCATTCATCATAAATATTCTGAAACTGATTCTGATCCACATAATGCAAAA
CGTGGATTCTTTTTTGCTCATGTCGGCTGGTTATTTTTAACACCACATCCTGATGTCGTT
GAAAAAAGAAAGTCAATTGATATGCGAGATTTGCAAGCAGATCCTTTACTTATGTGGCAG
AAAAAATATTATCCACCATTATTTGCTCTTCTAGTCATATTTTTTCCTACAATCGTGCCT
TATTATTTTTGGAATGAAGACTTGTGGATTTCTTTTTGGACAGCTTTTGTTTGTCGTTTT
GTAACTGTCTTAAATATTGCATTTTTTGTGAATAGCGTTGCACACATGTATGGAACAAAA
CCATATGATAAGAAAATTATGCCAGTAGAAAATTTAGCAGTTGCAATAACAGCAATGGGT
GAAGGTTGGCACAATTATCATCATGTCTTTCCCTATGATTATAAAACTGGTGAATTTGGT
GGATGGCAAGGATATAAATTTAATATCACAACAGCTCACATTGACTTTTTTGCTAAAATT
GGCTGGGCTTATGATCGAAAATATGCAAGTGCTGAAATGATTGCAAGAAAAGTTGCAAAA
TCAGGCGATGGAAGTCATTTTTTATCACATGAAGAAGCACACAAAACTTCAATTTATGGT
TATGGTGATAAAGATCTTGAAATTGAAGATGCTAAAGCATTAGAAAATTTAAAAGAATGA
>g115.t1 Gene=g115 Length=379
MAPEIMQPSNQSQNDKNIIHRVSTNKLDDNHNYNHANGNGKVEAENSHEVFKPKIRWPDF
IVQLSLHIGFLYGLYYLIALKAKFYTYIWFFVLIYVTGLGITAGAHRLWSHRSYKAKLPL
RVLLLIFFTIAGQRDAYTWAHDHRIHHKYSETDSDPHNAKRGFFFAHVGWLFLTPHPDVV
EKRKSIDMRDLQADPLLMWQKKYYPPLFALLVIFFPTIVPYYFWNEDLWISFWTAFVCRF
VTVLNIAFFVNSVAHMYGTKPYDKKIMPVENLAVAITAMGEGWHNYHHVFPYDYKTGEFG
GWQGYKFNITTAHIDFFAKIGWAYDRKYASAEMIARKVAKSGDGSHFLSHEEAHKTSIYG
YGDKDLEIEDAKALENLKE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 24 | g115.t1 | CDD | cd03505 | Delta9-FADS-like | 86 | 327 | 1.9921E-70 |
| 14 | g115.t1 | Coils | Coil | Coil | 368 | 379 | - |
| 2 | g115.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 13 | 377 | 2.3E-182 |
| 3 | g115.t1 | PANTHER | PTHR11351:SF61 | RH14937P | 13 | 377 | 2.3E-182 |
| 9 | g115.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 57 | 77 | 2.0E-51 |
| 7 | g115.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 106 | 126 | 2.0E-51 |
| 8 | g115.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 143 | 172 | 2.0E-51 |
| 4 | g115.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 204 | 222 | 2.0E-51 |
| 6 | g115.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 237 | 258 | 2.0E-51 |
| 5 | g115.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 280 | 294 | 2.0E-51 |
| 1 | g115.t1 | Pfam | PF00487 | Fatty acid desaturase | 89 | 291 | 6.0E-16 |
| 15 | g115.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 59 | - |
| 23 | g115.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 60 | 78 | - |
| 19 | g115.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 79 | 83 | - |
| 21 | g115.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 105 | - |
| 16 | g115.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 106 | 206 | - |
| 20 | g115.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 207 | 224 | - |
| 18 | g115.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 225 | 229 | - |
| 22 | g115.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 230 | 250 | - |
| 17 | g115.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 251 | 379 | - |
| 13 | g115.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 60 | 79 | - |
| 12 | g115.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 106 | - |
| 10 | g115.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 207 | 224 | - |
| 11 | g115.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 228 | 250 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
KEGG
Orthology
- This transcript has been annotated with K00507 (stearoyl-CoA desaturase (Delta-9 desaturase))
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
