| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1159 | g1159.t7 | TSS | g1159.t7 | 8422719 | 8422719 |
| chr_3 | g1159 | g1159.t7 | isoform | g1159.t7 | 8422830 | 8426879 |
| chr_3 | g1159 | g1159.t7 | exon | g1159.t7.exon1 | 8422830 | 8422957 |
| chr_3 | g1159 | g1159.t7 | cds | g1159.t7.CDS1 | 8422830 | 8422957 |
| chr_3 | g1159 | g1159.t7 | exon | g1159.t7.exon2 | 8426427 | 8426467 |
| chr_3 | g1159 | g1159.t7 | cds | g1159.t7.CDS2 | 8426427 | 8426467 |
| chr_3 | g1159 | g1159.t7 | exon | g1159.t7.exon3 | 8426535 | 8426809 |
| chr_3 | g1159 | g1159.t7 | cds | g1159.t7.CDS3 | 8426535 | 8426809 |
| chr_3 | g1159 | g1159.t7 | exon | g1159.t7.exon4 | 8426874 | 8426879 |
| chr_3 | g1159 | g1159.t7 | cds | g1159.t7.CDS4 | 8426874 | 8426879 |
| chr_3 | g1159 | g1159.t7 | TTS | g1159.t7 | 8427624 | 8427624 |
>g1159.t7 Gene=g1159 Length=450
ATGGCTGATGTACAAGAATACGATAACGGCGAACAAATGCAAGAAGATTTCCAGGGACAA
GGTGATCAATCTGGAGATAGTAACTATCAAAACGGAAATGGAGAAACTCAAGCTCGCGAT
GACGATCGAAAGCTGTTTGTCGGTGGTTTAAGTTGGGAAACAACAGAAAAGGAATTGCGT
GATCATTTTGGACAATATGGTGAAATTGACAGCATCAATGTTAAAACAGATCCTACAACT
GGTCGCTCACGTGGATTTGCATTCATTGTTTATAAAGCAGCTGATTCAATTGATAAAGTT
GTCGCTGCTGGTGATCATATCATTAACAACAAGAAAGTTGATCCTAAAAAAGCCAAGGCA
AGAACTGGCAAAATCTTTGTCGGTGGACTCATTCCAGAAATTAGTGATGATGAAATCAAG
GCATATTTCTCACAATTTGGAAATATTACT
>g1159.t7 Gene=g1159 Length=150
MADVQEYDNGEQMQEDFQGQGDQSGDSNYQNGNGETQARDDDRKLFVGGLSWETTEKELR
DHFGQYGEIDSINVKTDPTTGRSRGFAFIVYKAADSIDKVVAAGDHIINNKKVDPKKAKA
RTGKIFVGGLIPEISDDEIKAYFSQFGNIT
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g1159.t7 | CDD | cd12325 | RRM1_hnRNPA_hnRNPD_like | 45 | 116 | 7.50422E-38 |
| 5 | g1159.t7 | Gene3D | G3DSA:3.30.70.330 | - | 2 | 120 | 2.6E-27 |
| 6 | g1159.t7 | Gene3D | G3DSA:3.30.70.330 | - | 121 | 150 | 2.7E-6 |
| 9 | g1159.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 44 | - |
| 10 | g1159.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 11 | 35 | - |
| 2 | g1159.t7 | PANTHER | PTHR48033:SF8 | RNA-BINDING PROTEIN SQUID | 9 | 149 | 6.4E-62 |
| 3 | g1159.t7 | PANTHER | PTHR48033 | RNA-BINDING (RRM/RBD/RNP MOTIFS) FAMILY PROTEIN | 9 | 149 | 6.4E-62 |
| 1 | g1159.t7 | Pfam | PF00076 | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | 45 | 112 | 8.0E-18 |
| 12 | g1159.t7 | ProSiteProfiles | PS50102 | Eukaryotic RNA Recognition Motif (RRM) profile. | 43 | 125 | 17.097 |
| 11 | g1159.t7 | ProSiteProfiles | PS50102 | Eukaryotic RNA Recognition Motif (RRM) profile. | 123 | 150 | 8.586 |
| 8 | g1159.t7 | SMART | SM00360 | rrm1_1 | 44 | 116 | 8.1E-24 |
| 4 | g1159.t7 | SUPERFAMILY | SSF54928 | RNA-binding domain, RBD | 40 | 149 | 3.09E-33 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003676 | nucleic acid binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.