| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11608 | g11608.t4 | TSS | g11608.t4 | 17430574 | 17430574 |
| chr_1 | g11608 | g11608.t4 | isoform | g11608.t4 | 17430602 | 17432615 |
| chr_1 | g11608 | g11608.t4 | exon | g11608.t4.exon1 | 17430602 | 17430604 |
| chr_1 | g11608 | g11608.t4 | exon | g11608.t4.exon2 | 17432150 | 17432615 |
| chr_1 | g11608 | g11608.t4 | cds | g11608.t4.CDS1 | 17432157 | 17432615 |
| chr_1 | g11608 | g11608.t4 | TTS | g11608.t4 | 17432683 | 17432683 |
>g11608.t4 Gene=g11608 Length=469
AAGACACAAGATGCAGATCTTCGTCAAAACACTAACAGGCAAGACCATTACACTTGAGGT
CGAGCCATCTGATACAATCGAAAATGTCAAAGCTAAAATTCAAGACAAAGAAGGCATTCC
TCCAGATCAACAGCGTTTAATCTTTGCTGGTAAACAATTGGAGGATGGACGAACATTGAG
TGATTACAACATTCAAAAAGAATCAACATTGCATTTGGTCCTTCGTCTCCGCGGTGGTGC
CAAAAAACGCAAGAAGAAGAATTACTCAACACCGAAGAAGATCAAGCATAAGCGCAAGAA
GGTTAAACTTGCTGTTTTGAAGTACTACAAAGTTGATGAGAACGGCAAAATCCATCGATT
GAGACGTGAATGCCCGGCAGAAACATGCGGTGCTGGAGTCTTCATGGCAGCACATGAAAA
TCGCGCTTACTGTGGCAAATGTACACTCACATTCGTCGATAAGGAATAA
>g11608.t4 Gene=g11608 Length=152
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRE
CPAETCGAGVFMAAHENRAYCGKCTLTFVDKE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g11608.t4 | CDD | cd01803 | Ubl_ubiquitin | 1 | 76 | 2.08869E-56 |
| 10 | g11608.t4 | Gene3D | G3DSA:3.10.20.90 | - | 1 | 77 | 8.2E-45 |
| 11 | g11608.t4 | Gene3D | G3DSA:2.20.25.660 | - | 79 | 152 | 9.5E-38 |
| 3 | g11608.t4 | PANTHER | PTHR10666 | UBIQUITIN | 1 | 148 | 5.9E-89 |
| 4 | g11608.t4 | PANTHER | PTHR10666:SF291 | - | 1 | 148 | 5.9E-89 |
| 7 | g11608.t4 | PRINTS | PR00348 | Ubiquitin signature | 11 | 31 | 4.6E-39 |
| 6 | g11608.t4 | PRINTS | PR00348 | Ubiquitin signature | 32 | 52 | 4.6E-39 |
| 5 | g11608.t4 | PRINTS | PR00348 | Ubiquitin signature | 53 | 74 | 4.6E-39 |
| 2 | g11608.t4 | Pfam | PF00240 | Ubiquitin family | 3 | 74 | 2.3E-34 |
| 1 | g11608.t4 | Pfam | PF01599 | Ribosomal protein S27a | 102 | 147 | 1.2E-24 |
| 13 | g11608.t4 | ProSitePatterns | PS00299 | Ubiquitin domain signature. | 27 | 52 | - |
| 16 | g11608.t4 | ProSiteProfiles | PS50053 | Ubiquitin domain profile. | 1 | 76 | 31.018 |
| 15 | g11608.t4 | SMART | SM00213 | ubq_7 | 1 | 72 | 2.9E-36 |
| 14 | g11608.t4 | SMART | SM01402 | Ribosomal_S27_2 | 102 | 147 | 3.7E-27 |
| 9 | g11608.t4 | SUPERFAMILY | SSF54236 | Ubiquitin-like | 1 | 93 | 2.75E-36 |
| 8 | g11608.t4 | SUPERFAMILY | SSF57829 | Zn-binding ribosomal proteins | 100 | 150 | 1.83E-18 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0005515 | protein binding | MF |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.