| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11746 | g11746.t7 | isoform | g11746.t7 | 18216703 | 18217204 |
| chr_1 | g11746 | g11746.t7 | exon | g11746.t7.exon1 | 18216703 | 18216989 |
| chr_1 | g11746 | g11746.t7 | TTS | g11746.t7 | 18216730 | 18216730 |
| chr_1 | g11746 | g11746.t7 | cds | g11746.t7.CDS1 | 18216771 | 18216989 |
| chr_1 | g11746 | g11746.t7 | exon | g11746.t7.exon2 | 18217049 | 18217204 |
| chr_1 | g11746 | g11746.t7 | cds | g11746.t7.CDS2 | 18217049 | 18217204 |
| chr_1 | g11746 | g11746.t7 | TSS | g11746.t7 | 18217370 | 18217370 |
>g11746.t7 Gene=g11746 Length=443
ATGATTCTTAATTCTTGTCTGATTTCAAGAAATTTGTTTAGAAATACAAGTTTATTGTTT
TGTAAAAAATCATTTACAAACATAAACAACAGAAACATTTATAGATCCTCTCTATTGCAA
AGTCAATCCAGTTTGCTTATACCAAAGAATAATAAGATTAAAAACATACTAACTTTAAGA
CAAACAATAAAAGGATTCTGTACAAAGGCAAATGAATCAACTACTAAAGGACAAAAGGCA
GTAGGATGGTGGCTTGCAGGCTGTTCAGGCATGGTTTTTGTGGCTGTTGCATTAGGTGGG
ACTATACTTTATGGTTTGCTGCTAATATGCGTAATGGTTGTTGTCGATAAAATAATTTAC
AGAACCATTCGCTAAATATGTATCTTAATAAAAAGTATTACACAATTATAAAAATAATCA
TGTGAATTCTATTTAATATTTAT
>g11746.t7 Gene=g11746 Length=124
MILNSCLISRNLFRNTSLLFCKKSFTNINNRNIYRSSLLQSQSSLLIPKNNKIKNILTLR
QTIKGFCTKANESTTKGQKAVGWWLAGCSGMVFVAVALGGTILYGLLLICVMVVVDKIIY
RTIR
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 3 | g11746.t7 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 82 | - |
| 4 | g11746.t7 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 115 | - |
| 2 | g11746.t7 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 116 | 124 | - |
| 1 | g11746.t7 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 93 | 115 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.