| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11761 | g11761.t14 | isoform | g11761.t14 | 18272504 | 18273267 |
| chr_1 | g11761 | g11761.t14 | exon | g11761.t14.exon1 | 18272504 | 18272784 |
| chr_1 | g11761 | g11761.t14 | cds | g11761.t14.CDS1 | 18272505 | 18272784 |
| chr_1 | g11761 | g11761.t14 | exon | g11761.t14.exon2 | 18273248 | 18273267 |
| chr_1 | g11761 | g11761.t14 | cds | g11761.t14.CDS2 | 18273248 | 18273267 |
| chr_1 | g11761 | g11761.t14 | TSS | g11761.t14 | 18273485 | 18273485 |
| chr_1 | g11761 | g11761.t14 | TTS | g11761.t14 | NA | NA |
>g11761.t14 Gene=g11761 Length=301
ATGGATAAAAGAAAGCTATCCACCTCTGGCGATTCTTTATATGAAATTTTGGGACTGCCA
AAGACTTCATCACCAGAAGATATAAAGAAAACTTATAGAAAACTTGCTCTCAAATATCAT
CCAGATAAGAATCCTGAAAATCCTGAGGCTGCAGAAAAATTTAAAGAAGTCAATAGAGCA
CATAGCATATTAAGTGATCAAACTAAACGAAATATTTATGACAACTATGGTTCACTTGGA
TTATATATAGCTGAACAATTTGGTGAAGAAAATGTCAATGCATATTTTGTAGTGACATCA
C
>g11761.t14 Gene=g11761 Length=100
MDKRKLSTSGDSLYEILGLPKTSSPEDIKKTYRKLALKYHPDKNPENPEAAEKFKEVNRA
HSILSDQTKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g11761.t14 | CDD | cd06257 | DnaJ | 14 | 66 | 9.77991E-27 |
| 8 | g11761.t14 | Gene3D | G3DSA:1.10.287.110 | - | 1 | 100 | 7.7E-36 |
| 2 | g11761.t14 | PANTHER | PTHR44027 | DNAJ HOMOLOG SUBFAMILY C MEMBER 5 HOMOLOG | 2 | 100 | 8.2E-52 |
| 4 | g11761.t14 | PRINTS | PR00625 | DnaJ domain signature | 14 | 32 | 1.9E-26 |
| 3 | g11761.t14 | PRINTS | PR00625 | DnaJ domain signature | 32 | 47 | 1.9E-26 |
| 6 | g11761.t14 | PRINTS | PR00625 | DnaJ domain signature | 49 | 69 | 1.9E-26 |
| 5 | g11761.t14 | PRINTS | PR00625 | DnaJ domain signature | 69 | 88 | 1.9E-26 |
| 1 | g11761.t14 | Pfam | PF00226 | DnaJ domain | 13 | 74 | 1.6E-28 |
| 10 | g11761.t14 | ProSitePatterns | PS00636 | Nt-dnaJ domain signature. | 54 | 73 | - |
| 12 | g11761.t14 | ProSiteProfiles | PS50076 | dnaJ domain profile. | 12 | 77 | 23.704 |
| 11 | g11761.t14 | SMART | SM00271 | dnaj_3 | 11 | 69 | 2.8E-28 |
| 7 | g11761.t14 | SUPERFAMILY | SSF46565 | Chaperone J-domain | 12 | 94 | 1.13E-29 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.