Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g11797 g11797.t2 TTS g11797.t2 18480388 18480388
chr_1 g11797 g11797.t2 isoform g11797.t2 18480537 18480891
chr_1 g11797 g11797.t2 exon g11797.t2.exon1 18480537 18480891
chr_1 g11797 g11797.t2 cds g11797.t2.CDS1 18480537 18480647
chr_1 g11797 g11797.t2 TSS g11797.t2 NA NA

Sequences

>g11797.t2 Gene=g11797 Length=355
AACAATATTGAAGTCACCACAAATTGTTTTACTTGATGAAGCAACAAGTGCTCTCGATAC
TTCAACTGAGCGTAATATACAGGCAGCATTGTCGCGTGTTTGTGCAAATAAAACTACTAT
TATAATCGCTCATAGACTTTCCACAATCATTCATGCTGACGAAATTTTAGTTCTCAAAGA
TGGTGAGATTATAGAGAGGGGTCGACATGAGTTCTTGCTTGAAGAAAATGGACTTTATGC
AGAAATGTGGAATCAGCAACTAAAAAATTTGGAAGGCGAAAAATTACGTGATGAAAAAGT
TTTTGAGGAAAATTCATCGAGTACAGCACCATCACATCATAATTATCATCAATAA

>g11797.t2 Gene=g11797 Length=36
MWNQQLKNLEGEKLRDEKVFEENSSSTAPSHHNYHQ

Protein features from InterProScan

Transcript Database ID Name Start End E.value
g11797.t2 MobiDBLite mobidb-lite consensus disorder prediction 1 36 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values