| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11797 | g11797.t2 | TTS | g11797.t2 | 18480388 | 18480388 |
| chr_1 | g11797 | g11797.t2 | isoform | g11797.t2 | 18480537 | 18480891 |
| chr_1 | g11797 | g11797.t2 | exon | g11797.t2.exon1 | 18480537 | 18480891 |
| chr_1 | g11797 | g11797.t2 | cds | g11797.t2.CDS1 | 18480537 | 18480647 |
| chr_1 | g11797 | g11797.t2 | TSS | g11797.t2 | NA | NA |
>g11797.t2 Gene=g11797 Length=355
AACAATATTGAAGTCACCACAAATTGTTTTACTTGATGAAGCAACAAGTGCTCTCGATAC
TTCAACTGAGCGTAATATACAGGCAGCATTGTCGCGTGTTTGTGCAAATAAAACTACTAT
TATAATCGCTCATAGACTTTCCACAATCATTCATGCTGACGAAATTTTAGTTCTCAAAGA
TGGTGAGATTATAGAGAGGGGTCGACATGAGTTCTTGCTTGAAGAAAATGGACTTTATGC
AGAAATGTGGAATCAGCAACTAAAAAATTTGGAAGGCGAAAAATTACGTGATGAAAAAGT
TTTTGAGGAAAATTCATCGAGTACAGCACCATCACATCATAATTATCATCAATAA
>g11797.t2 Gene=g11797 Length=36
MWNQQLKNLEGEKLRDEKVFEENSSSTAPSHHNYHQ
| Transcript | Database | ID | Name | Start | End | E.value |
|---|---|---|---|---|---|---|
| g11797.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 36 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.