General information for g11839.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative 5-hydroxyisourate hydrolase.
Parent gene
- The parent gene g11839 is located on chr_1: 18693299..18694050 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11839 | g11839.t1 | TTS | g11839.t1 | 18693268 | 18693268 |
| chr_1 | g11839 | g11839.t1 | isoform | g11839.t1 | 18693299 | 18693769 |
| chr_1 | g11839 | g11839.t1 | exon | g11839.t1.exon1 | 18693299 | 18693388 |
| chr_1 | g11839 | g11839.t1 | cds | g11839.t1.CDS1 | 18693299 | 18693388 |
| chr_1 | g11839 | g11839.t1 | exon | g11839.t1.exon2 | 18693452 | 18693681 |
| chr_1 | g11839 | g11839.t1 | cds | g11839.t1.CDS2 | 18693452 | 18693681 |
| chr_1 | g11839 | g11839.t1 | exon | g11839.t1.exon3 | 18693739 | 18693769 |
| chr_1 | g11839 | g11839.t1 | cds | g11839.t1.CDS3 | 18693739 | 18693769 |
| chr_1 | g11839 | g11839.t1 | TSS | g11839.t1 | 18693785 | 18693785 |
Sequences
>g11839.t1 Gene=g11839 Length=351
ATGAGTAACAAACTTCCTCTTTCGACTCATGTTTTAGACACTACAGTTGGTCAACCAGGA
AAGAATATGAAAATTAAATTATTTAAATCTAAAGACAATTACTGGGCAAGTTCATCAACC
TCTTTTGTTACTGATGAAAATGGAAGATTCGGAGAATTTCTTAAAATTGATGATGAAGTG
TGTGGAACATACAAACTTAAATTTGAAGTGGAAGAATATTTTAAAAGTCAAGAAAAGGAA
TGCTTATATCCATTTGTTGAGATAGTTTTCAAAATATCATCGAGCAATGAACACTATCAT
ATTCCACTAATTATAACACCTTACAGTTATTCTACTTATCGTGGTTCTTAA
>g11839.t1 Gene=g11839 Length=116
MSNKLPLSTHVLDTTVGQPGKNMKIKLFKSKDNYWASSSTSFVTDENGRFGEFLKIDDEV
CGTYKLKFEVEEYFKSQEKECLYPFVEIVFKISSSNEHYHIPLIITPYSYSTYRGS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g11839.t1 | CDD | cd05822 | TLP_HIUase | 6 | 116 | 1.08411E-51 |
| 8 | g11839.t1 | Gene3D | G3DSA:2.60.40.180 | - | 1 | 115 | 5.3E-39 |
| 2 | g11839.t1 | PANTHER | PTHR10395:SF7 | 5-HYDROXYISOURATE HYDROLASE | 3 | 116 | 2.6E-37 |
| 3 | g11839.t1 | PANTHER | PTHR10395 | URICASE AND TRANSTHYRETIN-RELATED | 3 | 116 | 2.6E-37 |
| 6 | g11839.t1 | PRINTS | PR00189 | Transthyretin signature | 6 | 26 | 1.0E-11 |
| 4 | g11839.t1 | PRINTS | PR00189 | Transthyretin signature | 39 | 64 | 1.0E-11 |
| 5 | g11839.t1 | PRINTS | PR00189 | Transthyretin signature | 94 | 116 | 1.0E-11 |
| 1 | g11839.t1 | Pfam | PF00576 | HIUase/Transthyretin family | 7 | 115 | 8.8E-35 |
| 10 | g11839.t1 | ProSitePatterns | PS00768 | Transthyretin signature 1. | 10 | 25 | - |
| 11 | g11839.t1 | ProSitePatterns | PS00769 | Transthyretin signature 2. | 99 | 111 | - |
| 12 | g11839.t1 | SMART | SM00095 | transthy-fin | 2 | 115 | 4.6E-4 |
| 7 | g11839.t1 | SUPERFAMILY | SSF49472 | Transthyretin (synonym: prealbumin) | 5 | 116 | 4.19E-38 |
| 13 | g11839.t1 | TIGRFAM | TIGR02962 | hdxy_isourate: hydroxyisourate hydrolase | 6 | 116 | 3.1E-39 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006144 | purine nucleobase metabolic process | BP |
| GO:0033971 | hydroxyisourate hydrolase activity | MF |
KEGG
Orthology
- This transcript has been annotated with K07127 (5-hydroxyisourate hydrolase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
