Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g11948 g11948.t1 isoform g11948.t1 19584519 19584872
chr_1 g11948 g11948.t1 exon g11948.t1.exon1 19584519 19584728
chr_1 g11948 g11948.t1 cds g11948.t1.CDS1 19584519 19584728
chr_1 g11948 g11948.t1 exon g11948.t1.exon2 19584777 19584872
chr_1 g11948 g11948.t1 cds g11948.t1.CDS2 19584777 19584872
chr_1 g11948 g11948.t1 TTS g11948.t1 19584920 19584920
chr_1 g11948 g11948.t1 TSS g11948.t1 NA NA

Sequences

>g11948.t1 Gene=g11948 Length=306
ATGTTTCGTTTATTGATTGTTTCAACATTAATTGCCTGCGCATTGTCTGCAGTAGTTCCT
GATGCCACAGAAACTGAAGAATTTCGTCAATGGAGTGGTCGCATTGTAGGTGGACAGACA
GCAGCTCCTGGCCAATTTCCCTATCAAACATCTATGAGAAGTGCAGCAAACGCTCATTTT
TGTGGTGGTTTTATTATTAATCATCGCACTGTTTCATGGGGAGTTCCTTGCGGTACTGCT
TCACCAGATATGTTTGCTCGTATCTCTGCTGTCGCTACATGGCTCGATGCTAACACTGTC
AATTAA

>g11948.t1 Gene=g11948 Length=101
MFRLLIVSTLIACALSAVVPDATETEEFRQWSGRIVGGQTAAPGQFPYQTSMRSAANAHF
CGGFIINHRTVSWGVPCGTASPDMFARISAVATWLDANTVN

Protein features from InterProScan

Transcript Database ID Name Start End E.value
7 g11948.t1 Gene3D G3DSA:2.40.10.10 - 35 72 4.9E-11
2 g11948.t1 PANTHER PTHR24250 CHYMOTRYPSIN-RELATED 10 71 1.8E-12
3 g11948.t1 PANTHER PTHR24250:SF50 CHYMOTRYPSIN-LIKE-RELATED 10 71 1.8E-12
1 g11948.t1 Pfam PF00089 Trypsin 35 71 1.0E-6
9 g11948.t1 Phobius SIGNAL_PEPTIDE Signal peptide region 1 20 -
10 g11948.t1 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 3 -
11 g11948.t1 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 4 15 -
12 g11948.t1 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 16 20 -
8 g11948.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 21 101 -
4 g11948.t1 SUPERFAMILY SSF50494 Trypsin-like serine proteases 3 71 4.52E-13
6 g11948.t1 SignalP_EUK SignalP-noTM SignalP-noTM 1 16 -
13 g11948.t1 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM 1 19 -
5 g11948.t1 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM 1 22 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0004252 serine-type endopeptidase activity MF
GO:0006508 proteolysis BP

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed