| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11976 | g11976.t1 | TTS | g11976.t1 | 20128598 | 20128598 |
| chr_1 | g11976 | g11976.t1 | isoform | g11976.t1 | 20128696 | 20129267 |
| chr_1 | g11976 | g11976.t1 | exon | g11976.t1.exon1 | 20128696 | 20128809 |
| chr_1 | g11976 | g11976.t1 | cds | g11976.t1.CDS1 | 20128696 | 20128809 |
| chr_1 | g11976 | g11976.t1 | exon | g11976.t1.exon2 | 20128870 | 20129085 |
| chr_1 | g11976 | g11976.t1 | cds | g11976.t1.CDS2 | 20128870 | 20129085 |
| chr_1 | g11976 | g11976.t1 | exon | g11976.t1.exon3 | 20129139 | 20129267 |
| chr_1 | g11976 | g11976.t1 | cds | g11976.t1.CDS3 | 20129139 | 20129267 |
| chr_1 | g11976 | g11976.t1 | TSS | g11976.t1 | 20129346 | 20129346 |
>g11976.t1 Gene=g11976 Length=459
ATGGATGTTTTGAATACTTTAAAATATGAGAACGATGTCTTACGAGGCTACATTACATGG
AGTGGTATTTTATTGATCAAGCTCCTTTTGATGGCTTTTTTGACTGGTTTTAATCGTTTT
CGTAAAGGAGCTTATGAAAACCCAGAAGACATTCGTGGTCGTGAAAATGTTGAGATCAAG
AAAGATGAAGACGTTGAAAGAGTCAGACGTGCGCATTTAAATGATCTTGAGAATATTCCC
GCGTTCTTGTTTGCTGGTTTAGCTTATGTCTTCTCAAATCCAAACGTAGATTTAGCTTTG
TGGCTTTTCCGCATCGGTGTTCTCGCAAGAATTGGTCACACAATTGTTTATGCGATTTAT
CCAGTTCGACAGCCTGCACGGTTCATTACTTTTATCATCACTTTGCTTATAACACTCTTC
ATGATTATCGCATCAATCGCTGCATTCTTTCATCTTTAA
>g11976.t1 Gene=g11976 Length=152
MDVLNTLKYENDVLRGYITWSGILLIKLLLMAFLTGFNRFRKGAYENPEDIRGRENVEIK
KDEDVERVRRAHLNDLENIPAFLFAGLAYVFSNPNVDLALWLFRIGVLARIGHTIVYAIY
PVRQPARFITFIITLLITLFMIIASIAAFFHL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g11976.t1 | Gene3D | G3DSA:1.20.120.550 | - | 4 | 151 | 3.3E-52 |
| 2 | g11976.t1 | PANTHER | PTHR10689 | MICROSOMAL GLUTATHIONE S-TRANSFERASE 1 | 6 | 149 | 9.8E-44 |
| 3 | g11976.t1 | PANTHER | PTHR10689:SF6 | IP20101P-RELATED | 6 | 149 | 9.8E-44 |
| 1 | g11976.t1 | Pfam | PF01124 | MAPEG family | 18 | 146 | 2.6E-26 |
| 11 | g11976.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 16 | - |
| 15 | g11976.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 17 | 37 | - |
| 10 | g11976.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 38 | 75 | - |
| 17 | g11976.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 76 | 92 | - |
| 13 | g11976.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 93 | 97 | - |
| 16 | g11976.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 98 | 120 | - |
| 9 | g11976.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 121 | 126 | - |
| 14 | g11976.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 127 | 150 | - |
| 12 | g11976.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 151 | 152 | - |
| 7 | g11976.t1 | SUPERFAMILY | SSF161084 | MAPEG domain-like | 11 | 143 | 3.53E-34 |
| 4 | g11976.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 35 | - |
| 6 | g11976.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 99 | 121 | - |
| 5 | g11976.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 128 | 150 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.