General information for g11977.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Microsomal glutathione S-transferase 1.
Parent gene
- The parent gene g11977 is located on chr_1: 20130478..20131124 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11977 | g11977.t1 | isoform | g11977.t1 | 20130478 | 20131124 |
| chr_1 | g11977 | g11977.t1 | exon | g11977.t1.exon1 | 20130478 | 20130761 |
| chr_1 | g11977 | g11977.t1 | cds | g11977.t1.CDS1 | 20130478 | 20130761 |
| chr_1 | g11977 | g11977.t1 | exon | g11977.t1.exon2 | 20130820 | 20130912 |
| chr_1 | g11977 | g11977.t1 | cds | g11977.t1.CDS2 | 20130820 | 20130912 |
| chr_1 | g11977 | g11977.t1 | exon | g11977.t1.exon3 | 20131025 | 20131124 |
| chr_1 | g11977 | g11977.t1 | cds | g11977.t1.CDS3 | 20131025 | 20131124 |
| chr_1 | g11977 | g11977.t1 | TSS | g11977.t1 | NA | NA |
| chr_1 | g11977 | g11977.t1 | TTS | g11977.t1 | NA | NA |
Sequences
>g11977.t1 Gene=g11977 Length=477
ATGGAAACGCCAGAGGTGAAAATGACAGTTTACAATGCATTAAATGCAGATAATCATGCA
TTCCGAGTTTACATTACTTGGGGAGGATTTTTAATTATTAAAATGTTGTTAATGTCTTTA
CTCACTGGCATAACGCGTTCACGAAAAAATGCATTTGAAAATCCAGAAGATTTAGCAGTC
AACAAAGCTGGTGAGATCAAGAAAGATGAAGATGTTGAAAGAGTCAGACGCGCTCATATG
AATGACTTAGAGAATATTCCTGCCTTTCTTTTTGCTGCATTAATGTATGTCATGTCAAAT
CCACATCCAATCGTTGCTGCTTGGCTAATTCGCGTTGCTGTTCTAGCGAGAATTTTACAT
ACAATTTTTTATGCACTTTATCCATTACAGCCTTTTAGATCGATAAGCTGGGCCATAACT
TTAGCAATCACAATTTTTATGATTATCTGGGCGATAGTTATGCTTTTTCAAATTTAA
>g11977.t1 Gene=g11977 Length=158
METPEVKMTVYNALNADNHAFRVYITWGGFLIIKMLLMSLLTGITRSRKNAFENPEDLAV
NKAGEIKKDEDVERVRRAHMNDLENIPAFLFAALMYVMSNPHPIVAAWLIRVAVLARILH
TIFYALYPLQPFRSISWAITLAITIFMIIWAIVMLFQI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g11977.t1 | Gene3D | G3DSA:1.20.120.550 | - | 10 | 157 | 3.3E-52 |
| 2 | g11977.t1 | PANTHER | PTHR10689 | MICROSOMAL GLUTATHIONE S-TRANSFERASE 1 | 13 | 155 | 3.8E-43 |
| 3 | g11977.t1 | PANTHER | PTHR10689:SF6 | IP20101P-RELATED | 13 | 155 | 3.8E-43 |
| 1 | g11977.t1 | Pfam | PF01124 | MAPEG family | 25 | 152 | 5.6E-28 |
| 11 | g11977.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
| 15 | g11977.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 41 | - |
| 9 | g11977.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 42 | 82 | - |
| 14 | g11977.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 99 | - |
| 13 | g11977.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 100 | 104 | - |
| 16 | g11977.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 127 | - |
| 10 | g11977.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 128 | 133 | - |
| 17 | g11977.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 134 | 156 | - |
| 12 | g11977.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 157 | 158 | - |
| 7 | g11977.t1 | SUPERFAMILY | SSF161084 | MAPEG domain-like | 19 | 150 | 8.89E-37 |
| 4 | g11977.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 42 | - |
| 5 | g11977.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 127 | - |
| 6 | g11977.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 134 | 156 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K00799 (glutathione S-transferase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
