| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11978 | g11978.t10 | TSS | g11978.t10 | 20131511 | 20131511 |
| chr_1 | g11978 | g11978.t10 | isoform | g11978.t10 | 20131584 | 20132276 |
| chr_1 | g11978 | g11978.t10 | exon | g11978.t10.exon1 | 20131584 | 20131846 |
| chr_1 | g11978 | g11978.t10 | cds | g11978.t10.CDS1 | 20131584 | 20131846 |
| chr_1 | g11978 | g11978.t10 | exon | g11978.t10.exon2 | 20131903 | 20131999 |
| chr_1 | g11978 | g11978.t10 | cds | g11978.t10.CDS2 | 20131903 | 20131999 |
| chr_1 | g11978 | g11978.t10 | exon | g11978.t10.exon3 | 20132053 | 20132276 |
| chr_1 | g11978 | g11978.t10 | TTS | g11978.t10 | 20132272 | 20132272 |
>g11978.t10 Gene=g11978 Length=584
ATGAGTGTTTTTGATACATTAAATTACAATAACTATGCATTTCGCGTTTATATTACTTGG
GGAGGATTACTCCTTATTAAATTGCTATTTATGGCATTTTTGACATCATTTCAACGAATT
CGTAAAGGAGCTGTCGAAAATCCAGAAGATGTTGGTGTTCGCTCAAATATGGAGATCAAG
AAAGATGAAGATGTAGAGCGAGTGAGACGTGCTCATTTGAATGACCTTGAAAATATTCCA
GCATTTTTGTTTGCCGCATTGATGTATATTATGGCTGATCCTCATCCTATTGCCGCAGCA
TGGTTAATTCGTATTGCTGTTCTTGCAAGAATTGGTCATACAATTGTGTACGCTATGTAA
TTACCCTATTCGTCAACCTGCAAGAGGAATTTGCTTCTTCATAACTCTTGGCATCACTGT
CTTTATGATTATATGGTCAATGGTTATATTTTTCGAGATCTAAATAAGATAGTTTTCATA
ATATGTCCTTGAGATTAATTTCTATATGATAAATGTGCTTATAGATTAGTATTAAATGTG
TGTGAAAATCAAAAATAATAAATGTGAATTAATAATCTACAAAA
>g11978.t10 Gene=g11978 Length=119
MSVFDTLNYNNYAFRVYITWGGLLLIKLLFMAFLTSFQRIRKGAVENPEDVGVRSNMEIK
KDEDVERVRRAHLNDLENIPAFLFAALMYIMADPHPIAAAWLIRIAVLARIGHTIVYAM
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g11978.t10 | Gene3D | G3DSA:1.20.120.550 | - | 3 | 119 | 1.7E-42 |
| 2 | g11978.t10 | PANTHER | PTHR10689 | MICROSOMAL GLUTATHIONE S-TRANSFERASE 1 | 6 | 119 | 9.3E-34 |
| 3 | g11978.t10 | PANTHER | PTHR10689:SF6 | IP20101P-RELATED | 6 | 119 | 9.3E-34 |
| 1 | g11978.t10 | Pfam | PF01124 | MAPEG family | 18 | 118 | 1.7E-19 |
| 10 | g11978.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 11 | - |
| 13 | g11978.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
| 8 | g11978.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 35 | 75 | - |
| 14 | g11978.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 76 | 92 | - |
| 11 | g11978.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 93 | 97 | - |
| 12 | g11978.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 98 | 118 | - |
| 9 | g11978.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 119 | 119 | - |
| 6 | g11978.t10 | SUPERFAMILY | SSF161084 | MAPEG domain-like | 13 | 118 | 7.46E-29 |
| 5 | g11978.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 35 | - |
| 4 | g11978.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 81 | 103 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.