General information for g11981.t11
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g11981 is located on chr_1: 20134767..20135414 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11981 | g11981.t11 | isoform | g11981.t11 | 20134711 | 20135414 |
| chr_1 | g11981 | g11981.t11 | exon | g11981.t11.exon1 | 20134711 | 20134964 |
| chr_1 | g11981 | g11981.t11 | TTS | g11981.t11 | 20134714 | 20134714 |
| chr_1 | g11981 | g11981.t11 | cds | g11981.t11.CDS1 | 20134867 | 20134964 |
| chr_1 | g11981 | g11981.t11 | exon | g11981.t11.exon2 | 20135096 | 20135222 |
| chr_1 | g11981 | g11981.t11 | cds | g11981.t11.CDS2 | 20135096 | 20135222 |
| chr_1 | g11981 | g11981.t11 | exon | g11981.t11.exon3 | 20135286 | 20135414 |
| chr_1 | g11981 | g11981.t11 | cds | g11981.t11.CDS3 | 20135286 | 20135414 |
| chr_1 | g11981 | g11981.t11 | TSS | g11981.t11 | 20135467 | 20135467 |
Sequences
>g11981.t11 Gene=g11981 Length=510
ATGTCAATTTTAGAAATTTTAAGTCCTGAAAACGAAGTTTTTAGAGCATATGGTTTCTGG
GCTAGTGTCCTTGTTTTAAAAGTTTTAGGGATGGCTGTCTTAACAAGTATGGCAAGAAAA
AAGAAAAAGGCTATCAATAACCCTGAAGATCGTGTGTTTCTCAAGCCAGAAGATCAAAAT
GTTGAGCTTACTTCGTCTGATCCAGATGTAGAAAGAGTTAGAAGGTATTTTTCTTTAAAA
AAATTATTTCAGTTTCATTATCTCATTCGTTTATGTTTTGACAAATCCTTCAACATTCAT
TGGTGTAAATCTTATAAGAATCGGCGTGGTATCTCGTATTGTTCATTCTTATAGTTATCT
TAATGCTTTACAACCATACAGAGGCTACGGATTTGGCATAACTTTTTTGGTAATGATTTA
TATGAGTCTTTCAAATATTTTATATTTCTTGTAAATAATTGCACCACTTCTTTAATAAAA
TAAAGTATATCAGCATTGATTAAAAACAAA
>g11981.t11 Gene=g11981 Length=117
MSILEILSPENEVFRAYGFWASVLVLKVLGMAVLTSMARKKKKAINNPEDRVFLKPEDQN
VELTSSDPDVERVRRYFSLKKLFQFHYLIRLCFDKSFNIHWCKSYKNRRGISYCSFL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g11981.t11 | Gene3D | G3DSA:1.20.120.550 | - | 4 | 79 | 5.9E-17 |
| 1 | g11981.t11 | PANTHER | PTHR10689 | MICROSOMAL GLUTATHIONE S-TRANSFERASE 1 | 7 | 76 | 1.0E-11 |
| 6 | g11981.t11 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 16 | - |
| 7 | g11981.t11 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 17 | 38 | - |
| 5 | g11981.t11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 39 | 117 | - |
| 3 | g11981.t11 | SUPERFAMILY | SSF161084 | MAPEG domain-like | 11 | 76 | 8.83E-10 |
| 2 | g11981.t11 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 15 | 37 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
