General information for g12036.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g12036 is located on chr_1: 20578371..20578659 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12036 | g12036.t1 | TSS | g12036.t1 | 20578180 | 20578180 |
| chr_1 | g12036 | g12036.t1 | isoform | g12036.t1 | 20578371 | 20578659 |
| chr_1 | g12036 | g12036.t1 | exon | g12036.t1.exon1 | 20578371 | 20578548 |
| chr_1 | g12036 | g12036.t1 | cds | g12036.t1.CDS1 | 20578371 | 20578548 |
| chr_1 | g12036 | g12036.t1 | exon | g12036.t1.exon2 | 20578616 | 20578659 |
| chr_1 | g12036 | g12036.t1 | cds | g12036.t1.CDS2 | 20578616 | 20578659 |
| chr_1 | g12036 | g12036.t1 | TTS | g12036.t1 | 20578913 | 20578913 |
Sequences
>g12036.t1 Gene=g12036 Length=222
ATGTTGGAAATTACTTGTAATGATCGTCTAGGAAAGAAAGTGAGAGTCAAATGTAATCCA
GATGATACAATAGGCGACCTGAAGAAACTTATTGCTGCACAAACCGGCACTAGATATGAT
AAAATTGTCTTAAAAAAATGGTACACAATTTATAAAGATAACATTCGACTATCAGACTAT
GAAATTCATGATGGAATGAACTTGGAAATGTATTATCAATAA
>g12036.t1 Gene=g12036 Length=73
MLEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRYDKIVLKKWYTIYKDNIRLSDY
EIHDGMNLEMYYQ
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g12036.t1 | CDD | cd01791 | Ubl_UBL5 | 1 | 71 | 9.19257E-48 |
| 5 | g12036.t1 | Coils | Coil | Coil | 71 | 73 | - |
| 4 | g12036.t1 | Gene3D | G3DSA:3.10.20.90 | - | 1 | 73 | 3.1E-29 |
| 2 | g12036.t1 | PANTHER | PTHR13042 | UBIQUITIN-LIKE PROTEIN 5 | 1 | 73 | 9.6E-46 |
| 1 | g12036.t1 | Pfam | PF00240 | Ubiquitin family | 11 | 70 | 3.9E-5 |
| 6 | g12036.t1 | ProSiteProfiles | PS50053 | Ubiquitin domain profile. | 2 | 73 | 9.112 |
| 3 | g12036.t1 | SUPERFAMILY | SSF54236 | Ubiquitin-like | 1 | 72 | 2.16E-25 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006464 | cellular protein modification process | BP |
| GO:0005515 | protein binding | MF |
KEGG
Orthology
- This transcript has been annotated with K13113 (ubiquitin-like protein 5)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
