General information for g12066.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g12066 is located on chr_1: 20730520..20731808 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12066 | g12066.t3 | TSS | g12066.t3 | 20720062 | 20720062 |
| chr_1 | g12066 | g12066.t3 | isoform | g12066.t3 | 20720549 | 20728991 |
| chr_1 | g12066 | g12066.t3 | exon | g12066.t3.exon1 | 20720549 | 20720648 |
| chr_1 | g12066 | g12066.t3 | cds | g12066.t3.CDS1 | 20720549 | 20720648 |
| chr_1 | g12066 | g12066.t3 | exon | g12066.t3.exon2 | 20728719 | 20728991 |
| chr_1 | g12066 | g12066.t3 | cds | g12066.t3.CDS2 | 20728719 | 20728990 |
| chr_1 | g12066 | g12066.t3 | TTS | g12066.t3 | NA | NA |
Sequences
>g12066.t3 Gene=g12066 Length=373
ATGTTGGATACGATTATAATTGGATTACTTATTTTGTCGGCATTGGTGTATGGATTTTGG
CAATACTTTGCCGAGTCTGATGCCCGTGAAAAGAAGCAAAATGAGGCACATAAGAAAATT
GATGAATATGCACCAAAGAGCAACAAGTCATCGATTACAAAAAAAGCAACAGAAGGAAAC
AACAATAATAACAGCAACAACGGTAATAAGTCAAATATCAACAAAAATTCAAAGCGTTCA
AATTTAAAAAAACGTACAGACAAGGCAAATTATTCCCACAATTGGCTTTTGACCACATTG
AAGGGACATACAGGCAACGTTATGGACATGGATTTTTCATCAAATGGGAAATATCTTGCT
ACATGTGCTGACG
>g12066.t3 Gene=g12066 Length=124
MLDTIIIGLLILSALVYGFWQYFAESDAREKKQNEAHKKIDEYAPKSNKSSITKKATEGN
NNNNSNNGNKSNINKNSKRSNLKKRTDKANYSHNWLLTTLKGHTGNVMDMDFSSNGKYLA
TCAD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g12066.t3 | Gene3D | G3DSA:2.130.10.10 | - | 21 | 124 | 1.7E-9 |
| 4 | g12066.t3 | MobiDBLite | mobidb-lite | consensus disorder prediction | 31 | 87 | - |
| 5 | g12066.t3 | MobiDBLite | mobidb-lite | consensus disorder prediction | 31 | 45 | - |
| 6 | g12066.t3 | MobiDBLite | mobidb-lite | consensus disorder prediction | 46 | 76 | - |
| 1 | g12066.t3 | PANTHER | PTHR44321 | TRANSDUCIN BETA-LIKE PROTEIN 2 | 3 | 124 | 1.3E-16 |
| 10 | g12066.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 5 | - |
| 11 | g12066.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 6 | 24 | - |
| 9 | g12066.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 25 | 124 | - |
| 3 | g12066.t3 | SUPERFAMILY | SSF50978 | WD40 repeat-like | 92 | 123 | 1.1E-5 |
| 7 | g12066.t3 | SignalP_EUK | SignalP-TM | SignalP-TM | 1 | 18 | - |
| 2 | g12066.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 5 | 24 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
