General information for g12091.t9
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g12091 is located on chr_1: 20887255..20888346 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12091 | g12091.t9 | TTS | g12091.t9 | 20886792 | 20886792 |
| chr_1 | g12091 | g12091.t9 | isoform | g12091.t9 | 20887255 | 20887575 |
| chr_1 | g12091 | g12091.t9 | exon | g12091.t9.exon1 | 20887255 | 20887575 |
| chr_1 | g12091 | g12091.t9 | cds | g12091.t9.CDS1 | 20887256 | 20887441 |
| chr_1 | g12091 | g12091.t9 | TSS | g12091.t9 | 20888086 | 20888086 |
Sequences
>g12091.t9 Gene=g12091 Length=321
CAGTGATTTATATTACATCATTTCTGCCATTGTTTGATAAACAAAATTATCAAATCAGCA
GACATGCAGTTAGGATTAAAGTTCAAGGTGGATTTTGTTTACATTTTCTAGATATATGGC
ACGTCATTCAAAGCATGACTGTGATTGCGAAAAAAGAGTTGCTATATGCGGGGCCTTTCG
GCATTGCCGCTTATCTATCGGGTTTAATTTTTATTGATCGTCATAGCTCGAAAGGAAAAG
AAACAATGAATCAAGCAATGGAAGTGCTTAAGAAAAACAACACAAAACTGTGGATATTCC
CAGAAGGTAAAAAAAACTTAT
>g12091.t9 Gene=g12091 Length=62
MTVIAKKELLYAGPFGIAAYLSGLIFIDRHSSKGKETMNQAMEVLKKNNTKLWIFPEGKK
NL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g12091.t9 | PANTHER | PTHR10434:SF50 | 1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE | 2 | 60 | 1.2E-18 |
| 3 | g12091.t9 | PANTHER | PTHR10434 | 1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE | 2 | 60 | 1.2E-18 |
| 1 | g12091.t9 | Pfam | PF01553 | Acyltransferase | 2 | 61 | 3.8E-11 |
| 6 | g12091.t9 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 8 | - |
| 8 | g12091.t9 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 9 | 27 | - |
| 7 | g12091.t9 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 28 | 62 | - |
| 5 | g12091.t9 | SUPERFAMILY | SSF69593 | Glycerol-3-phosphate (1)-acyltransferase | 2 | 58 | 6.02E-13 |
| 4 | g12091.t9 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 10 | 27 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016746 | acyltransferase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
