General information for g1210.t4
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Dedicator of cytokinesis protein 1.
Parent gene
- The parent gene g1210 is located on chr_3: 8784995..8789566 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1210 | g1210.t4 | isoform | g1210.t4 | 8779554 | 8785986 |
| chr_3 | g1210 | g1210.t4 | exon | g1210.t4.exon1 | 8779554 | 8779703 |
| chr_3 | g1210 | g1210.t4 | cds | g1210.t4.CDS1 | 8779554 | 8779703 |
| chr_3 | g1210 | g1210.t4 | TTS | g1210.t4 | 8779598 | 8779598 |
| chr_3 | g1210 | g1210.t4 | exon | g1210.t4.exon2 | 8779763 | 8779922 |
| chr_3 | g1210 | g1210.t4 | cds | g1210.t4.CDS2 | 8779763 | 8779922 |
| chr_3 | g1210 | g1210.t4 | exon | g1210.t4.exon3 | 8780173 | 8780284 |
| chr_3 | g1210 | g1210.t4 | cds | g1210.t4.CDS3 | 8780173 | 8780284 |
| chr_3 | g1210 | g1210.t4 | exon | g1210.t4.exon4 | 8785941 | 8785986 |
| chr_3 | g1210 | g1210.t4 | cds | g1210.t4.CDS4 | 8785941 | 8785986 |
| chr_3 | g1210 | g1210.t4 | TSS | g1210.t4 | 8786111 | 8786111 |
Sequences
>g1210.t4 Gene=g1210 Length=468
ATGGAGTCGTGGAAAAGTGTCGGAAAGCAATATTTGTTTGGAATAGCCAAACATAATTTT
CAACAAGACGATAAGCCGCACAGATTGTGTTTGGATGTCGGTGACAGTTTAATAATCATT
CGTGAAAGTGCGCATTGGTACTATGGATATAAAAAGAAAAATCGTTCATTGAAAGGCATT
TTTCCAAAAACTTATGTTCATCTTATTGCCGACGTTGAGATTGCTCGAGGTGAATACGTA
ATTAAACGTAGTGAAATTGTCGACGAAATAACAACAATTTTGAAGGAATGGCACGAGCAT
TTTAAGAAATTTTACTTGACAAATAATCCAAATTTAAAAGTGCTCCGTGAAAAGATGCTT
GAGTTAATTAAACTGCGTTCTCAAATGCTGTCGGGAAATCTGCCAGTGGATGAAATGAAA
GACAAAAAAATGAAAGCAACATCACAAATCGACACAGGAAATAAATTA
>g1210.t4 Gene=g1210 Length=156
MESWKSVGKQYLFGIAKHNFQQDDKPHRLCLDVGDSLIIIRESAHWYYGYKKKNRSLKGI
FPKTYVHLIADVEIARGEYVIKRSEIVDEITTILKEWHEHFKKFYLTNNPNLKVLREKML
ELIKLRSQMLSGNLPVDEMKDKKMKATSQIDTGNKL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g1210.t4 | CDD | cd11872 | SH3_DOCK_AB | 13 | 68 | 0.0000000 |
| 6 | g1210.t4 | Gene3D | G3DSA:2.30.30.40 | SH3 Domains | 2 | 70 | 0.0000000 |
| 7 | g1210.t4 | Gene3D | G3DSA:1.20.1270.350 | - | 80 | 156 | 0.0000000 |
| 2 | g1210.t4 | PANTHER | PTHR45653:SF10 | MYOBLAST CITY, ISOFORM B | 5 | 156 | 0.0000000 |
| 3 | g1210.t4 | PANTHER | PTHR45653 | DEDICATOR OF CYTOKINESIS | 5 | 156 | 0.0000000 |
| 1 | g1210.t4 | Pfam | PF16172 | DOCK N-terminus | 79 | 156 | 0.0000000 |
| 8 | g1210.t4 | ProSiteProfiles | PS50002 | Src homology 3 (SH3) domain profile. | 9 | 71 | 14.0850000 |
| 5 | g1210.t4 | SMART | SM00326 | SH3_2 | 12 | 70 | 0.0000026 |
| 4 | g1210.t4 | SUPERFAMILY | SSF50044 | SH3-domain | 11 | 72 | 0.0000000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
| GO:0007264 | small GTPase mediated signal transduction | BP |
| GO:0005085 | guanyl-nucleotide exchange factor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed