| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12102 | g12102.t23 | TSS | g12102.t23 | 20939009 | 20939009 |
| chr_1 | g12102 | g12102.t23 | isoform | g12102.t23 | 20939077 | 20940413 |
| chr_1 | g12102 | g12102.t23 | exon | g12102.t23.exon1 | 20939077 | 20939091 |
| chr_1 | g12102 | g12102.t23 | cds | g12102.t23.CDS1 | 20939077 | 20939091 |
| chr_1 | g12102 | g12102.t23 | exon | g12102.t23.exon2 | 20939358 | 20939631 |
| chr_1 | g12102 | g12102.t23 | cds | g12102.t23.CDS2 | 20939358 | 20939631 |
| chr_1 | g12102 | g12102.t23 | exon | g12102.t23.exon3 | 20939691 | 20939911 |
| chr_1 | g12102 | g12102.t23 | cds | g12102.t23.CDS3 | 20939691 | 20939911 |
| chr_1 | g12102 | g12102.t23 | exon | g12102.t23.exon4 | 20940190 | 20940413 |
| chr_1 | g12102 | g12102.t23 | cds | g12102.t23.CDS4 | 20940190 | 20940219 |
| chr_1 | g12102 | g12102.t23 | TTS | g12102.t23 | 20940505 | 20940505 |
>g12102.t23 Gene=g12102 Length=734
ATGGTCGCTAAAAAGCCAGTAAGCAAAAAGAAGGTTGTTGGTAAAAAAGTGGCTGCTGCT
CCTCTTTCAAAATCAGCAGTACAAAAGAAAACTGCTAGCAATCCATTGTTCGAAAAACGT
CCCAAGAATTATGGTATTGGTCAAAACGTTCAACCAAAACGTGATCTATCACGTTTCGTT
AGATGGCCAAAATATATTCGTATTCAGCGCCATAAAGCTATCTTGCAAAAAAGATTGAAG
GTTCCACCACCAATTAATCAATTTTCTCAAGCTTTAGATAAGCAAACAGCCGTTCAATTA
TTTAAAGTTTTGGAAAAATATCGTCCAGAATCAAAGTTGCAAAAAGCTGCTCGTTTGAAG
AAAAAGGCTGAAGAAAAGGTTGCAGGCAAGGATGATGCTCCATCAAAGAAGAAATTGACA
TTGAGAGCTGGTTGCAACACAGTCACCAAGTTGGTTGAGCAAAAGAAGGCACAATTAGTT
GTCATCTCACATGACGTTGATCCAATCGAATGGTTCATCGCAAAACATGCACAACTTTAG
CTTTGTGCAATGTTGATAATGCTGATCGCGCAAACTTCTCAAAGATCGTGGAATCAATTA
AGACCAACTATAATGATCGTTATGATGAAATTCGTCGTCATTGGGGTGGTGGTTTACTCG
GACCAAAATCAATGGCTCGTATTGCTAAGGTTGAAAAGGCTAAAGCTCGTGAATTAGCCC
AAAAACAAGGATAA
>g12102.t23 Gene=g12102 Length=179
MVAKKPVSKKKVVGKKVAAAPLSKSAVQKKTASNPLFEKRPKNYGIGQNVQPKRDLSRFV
RWPKYIRIQRHKAILQKRLKVPPPINQFSQALDKQTAVQLFKVLEKYRPESKLQKAARLK
KKAEEKVAGKDDAPSKKKLTLRAGCNTVTKLVEQKKAQLVVISHDVDPIEWFIAKHAQL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 14 | g12102.t23 | Gene3D | G3DSA:3.30.1330.210 | - | 62 | 175 | 1.4E-47 |
| 12 | g12102.t23 | MobiDBLite | mobidb-lite | consensus disorder prediction | 23 | 46 | - |
| 2 | g12102.t23 | PANTHER | PTHR23105:SF134 | - | 12 | 173 | 8.4E-57 |
| 3 | g12102.t23 | PANTHER | PTHR23105 | RIBOSOMAL PROTEIN L7AE FAMILY MEMBER | 12 | 173 | 8.4E-57 |
| 8 | g12102.t23 | PRINTS | PR00882 | Ribosomal protein L7A family signature | 41 | 58 | 9.8E-46 |
| 5 | g12102.t23 | PRINTS | PR00882 | Ribosomal protein L7A family signature | 58 | 75 | 9.8E-46 |
| 7 | g12102.t23 | PRINTS | PR00882 | Ribosomal protein L7A family signature | 78 | 97 | 9.8E-46 |
| 4 | g12102.t23 | PRINTS | PR00882 | Ribosomal protein L7A family signature | 102 | 115 | 9.8E-46 |
| 6 | g12102.t23 | PRINTS | PR00882 | Ribosomal protein L7A family signature | 137 | 157 | 9.8E-46 |
| 10 | g12102.t23 | PRINTS | PR00881 | Ribosomal protein L7A/RS6 family signature | 141 | 155 | 5.1E-7 |
| 9 | g12102.t23 | PRINTS | PR00881 | Ribosomal protein L7A/RS6 family signature | 160 | 173 | 5.1E-7 |
| 1 | g12102.t23 | Pfam | PF01248 | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family | 135 | 170 | 1.9E-7 |
| 11 | g12102.t23 | SUPERFAMILY | SSF55315 | L30e-like | 97 | 171 | 3.73E-13 |
| 13 | g12102.t23 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 19 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed