Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g1224 g1224.t5 TSS g1224.t5 8905168 8905168
chr_3 g1224 g1224.t5 isoform g1224.t5 8905402 8905880
chr_3 g1224 g1224.t5 exon g1224.t5.exon1 8905402 8905491
chr_3 g1224 g1224.t5 exon g1224.t5.exon2 8905544 8905739
chr_3 g1224 g1224.t5 cds g1224.t5.CDS1 8905602 8905739
chr_3 g1224 g1224.t5 exon g1224.t5.exon3 8905797 8905880
chr_3 g1224 g1224.t5 cds g1224.t5.CDS2 8905797 8905880
chr_3 g1224 g1224.t5 TTS g1224.t5 8905886 8905886

Sequences

>g1224.t5 Gene=g1224 Length=370
CACAATAAATCAAGTTACAATTGATGGTTGTAAAAAAGAAAGAGATTCTCAAAATAACTG
TAAATTAAGAAGATTGCATAATGCATCAATTGTTTTTGATTTTACGCCTGATTTTGACAC
CGCTGAAGGTGATGATGTGTTTTTGGGAATGTACACAACACGACCTGCAGAAACAATTTG
GCCAGGAATGGATACAAATGCATGCAATCATATGACATGTCCTGTTGTGAAAAATCAATT
GAATCATTACACTTATTTTGTCAATATTCCACAATCTTATCCTAGAGGTTTATTTACAGT
TCGATTTTTGATGAAAAAAGCAGGAATTCCTAAATGTTGCTTCTTGACTAAAATTAGCAT
TGCAGCTTAA

>g1224.t5 Gene=g1224 Length=73
MYTTRPAETIWPGMDTNACNHMTCPVVKNQLNHYTYFVNIPQSYPRGLFTVRFLMKKAGI
PKCCFLTKISIAA

Protein features from InterProScan

Transcript Database ID Name Start End E.value
3 g1224.t5 Gene3D G3DSA:2.60.40.770 - 3 73 0.0e+00
1 g1224.t5 Pfam PF02221 ML domain 15 71 5.4e-05
2 g1224.t5 SUPERFAMILY SSF81296 E set domains 8 71 0.0e+00

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed