General information for g12311.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g12311 is located on chr_1: 22334879..22343340 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12311 | g12311.t10 | TTS | g12311.t10 | 22334748 | 22334748 |
| chr_1 | g12311 | g12311.t10 | isoform | g12311.t10 | 22334879 | 22335257 |
| chr_1 | g12311 | g12311.t10 | exon | g12311.t10.exon1 | 22334879 | 22335015 |
| chr_1 | g12311 | g12311.t10 | cds | g12311.t10.CDS1 | 22334879 | 22335015 |
| chr_1 | g12311 | g12311.t10 | exon | g12311.t10.exon2 | 22335076 | 22335257 |
| chr_1 | g12311 | g12311.t10 | cds | g12311.t10.CDS2 | 22335076 | 22335172 |
| chr_1 | g12311 | g12311.t10 | TSS | g12311.t10 | 22336088 | 22336088 |
Sequences
>g12311.t10 Gene=g12311 Length=319
AAAGGAAAAGGAGGACTGGAAGAAGCTGTCGATTCAAGAAAAGAAAGCCCTCTATCGTGC
ATCATTCTGTCAGACATTCGCTGAAATGAAATATCCAACAGGAGAATGGAAAATGCACTT
GGGTAACACACTTATTGTTTTCGCATTAGCAATCTACATTTCACTGTGGATGGCTGCCTA
TATCTACGATCCAGATCCCATTTCATTTGATGAAGAACACCAAAAAGCTCAACTTAAACG
TATGCTTACATTGGAAGTCAATCCTATTCATGGTCTCTCAGCCAATTGGGACTATGAAAA
CAAGAGATGGAAGAAGTAA
>g12311.t10 Gene=g12311 Length=77
MKYPTGEWKMHLGNTLIVFALAIYISLWMAAYIYDPDPISFDEEHQKAQLKRMLTLEVNP
IHGLSANWDYENKRWKK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g12311.t10 | Gene3D | G3DSA:1.10.442.10 | Cytochrome C Oxidase | 1 | 77 | 1.5E-26 |
| 2 | g12311.t10 | PANTHER | PTHR10707 | CYTOCHROME C OXIDASE SUBUNIT IV | 1 | 77 | 5.8E-19 |
| 3 | g12311.t10 | PRINTS | PR01873 | Cytochrome c oxidase subunit IV signature | 32 | 45 | 6.7E-8 |
| 4 | g12311.t10 | PRINTS | PR01873 | Cytochrome c oxidase subunit IV signature | 60 | 76 | 6.7E-8 |
| 1 | g12311.t10 | Pfam | PF02936 | Cytochrome c oxidase subunit IV | 1 | 76 | 1.3E-23 |
| 8 | g12311.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 10 | g12311.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
| 9 | g12311.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 35 | 77 | - |
| 6 | g12311.t10 | SUPERFAMILY | SSF81406 | Mitochondrial cytochrome c oxidase subunit IV | 1 | 77 | 8.24E-26 |
| 5 | g12311.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004129 | cytochrome-c oxidase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
