| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12311 | g12311.t16 | TTS | g12311.t16 | 22334748 | 22334748 |
| chr_1 | g12311 | g12311.t16 | isoform | g12311.t16 | 22334879 | 22335593 |
| chr_1 | g12311 | g12311.t16 | exon | g12311.t16.exon1 | 22334879 | 22334970 |
| chr_1 | g12311 | g12311.t16 | cds | g12311.t16.CDS1 | 22334879 | 22334970 |
| chr_1 | g12311 | g12311.t16 | exon | g12311.t16.exon2 | 22335076 | 22335268 |
| chr_1 | g12311 | g12311.t16 | cds | g12311.t16.CDS2 | 22335076 | 22335268 |
| chr_1 | g12311 | g12311.t16 | exon | g12311.t16.exon3 | 22335329 | 22335593 |
| chr_1 | g12311 | g12311.t16 | cds | g12311.t16.CDS3 | 22335329 | 22335565 |
| chr_1 | g12311 | g12311.t16 | TSS | g12311.t16 | 22336088 | 22336088 |
>g12311.t16 Gene=g12311 Length=550
GGGAATAAAAAATCCACATACTTTAAAAATGGCGAGTCGAATGATGGCATTGGCTTTACG
TCATCAACCAGCCGCTTCAAAGACATCTTTGATTGTTCGTGCAGCTCACTCAGGCTCAGT
GAACCCTCATCTTGCTGAAAAATTAGAGAAGCTTGGTAATCGCGATGTTGTCGGTTTCGG
ATGGAACGGAGAACCAACTTACTACGATAGGCCAGATTTTCCCATGCCTGCCATTCGTTT
TAAGGAAAACACTCCAGATGTTTTGGCTCTTAGAGCAAAGGAAAAGGAGGACTGGAAGAA
GCTGTCGATTCAAGAAAAGAAAGCCCTCTATCGTGCATCATTCTGTCAGACATTCGCTGA
AATGAAATATCCAACAGGAGAATGGAAAATGCACTTGGGTAACACACTTATTGTTTTCGC
ATTAGCAATCTACATTTCACTGTGGATGGCTGCCTATACTCAACTTAAACGTATGCTTAC
ATTGGAAGTCAATCCTATTCATGGTCTCTCAGCCAATTGGGACTATGAAAACAAGAGATG
GAAGAAGTAA
>g12311.t16 Gene=g12311 Length=173
MASRMMALALRHQPAASKTSLIVRAAHSGSVNPHLAEKLEKLGNRDVVGFGWNGEPTYYD
RPDFPMPAIRFKENTPDVLALRAKEKEDWKKLSIQEKKALYRASFCQTFAEMKYPTGEWK
MHLGNTLIVFALAIYISLWMAAYTQLKRMLTLEVNPIHGLSANWDYENKRWKK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g12311.t16 | CDD | cd00922 | Cyt_c_Oxidase_IV | 46 | 166 | 4.48976E-54 |
| 7 | g12311.t16 | Gene3D | G3DSA:1.10.442.10 | Cytochrome C Oxidase | 46 | 173 | 5.7E-46 |
| 2 | g12311.t16 | PANTHER | PTHR10707 | CYTOCHROME C OXIDASE SUBUNIT IV | 5 | 173 | 6.0E-36 |
| 4 | g12311.t16 | PRINTS | PR01873 | Cytochrome c oxidase subunit IV signature | 59 | 72 | 8.1E-8 |
| 3 | g12311.t16 | PRINTS | PR01873 | Cytochrome c oxidase subunit IV signature | 102 | 120 | 8.1E-8 |
| 1 | g12311.t16 | Pfam | PF02936 | Cytochrome c oxidase subunit IV | 51 | 172 | 3.2E-39 |
| 8 | g12311.t16 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 121 | - |
| 10 | g12311.t16 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 122 | 142 | - |
| 9 | g12311.t16 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 143 | 173 | - |
| 5 | g12311.t16 | SUPERFAMILY | SSF81406 | Mitochondrial cytochrome c oxidase subunit IV | 46 | 173 | 2.75E-47 |
| 6 | g12311.t16 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 17 | - |
| 12 | g12311.t16 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 121 | 143 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004129 | cytochrome-c oxidase activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed