| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12311 | g12311.t9 | TTS | g12311.t9 | 22334748 | 22334748 |
| chr_1 | g12311 | g12311.t9 | isoform | g12311.t9 | 22334758 | 22335565 |
| chr_1 | g12311 | g12311.t9 | exon | g12311.t9.exon1 | 22334758 | 22334828 |
| chr_1 | g12311 | g12311.t9 | cds | g12311.t9.CDS1 | 22334759 | 22334828 |
| chr_1 | g12311 | g12311.t9 | exon | g12311.t9.exon2 | 22334883 | 22335015 |
| chr_1 | g12311 | g12311.t9 | cds | g12311.t9.CDS2 | 22334883 | 22335015 |
| chr_1 | g12311 | g12311.t9 | exon | g12311.t9.exon3 | 22335076 | 22335268 |
| chr_1 | g12311 | g12311.t9 | cds | g12311.t9.CDS3 | 22335076 | 22335268 |
| chr_1 | g12311 | g12311.t9 | exon | g12311.t9.exon4 | 22335329 | 22335565 |
| chr_1 | g12311 | g12311.t9 | cds | g12311.t9.CDS4 | 22335329 | 22335565 |
| chr_1 | g12311 | g12311.t9 | TSS | g12311.t9 | 22336088 | 22336088 |
>g12311.t9 Gene=g12311 Length=634
ATGGCGAGTCGAATGATGGCATTGGCTTTACGTCATCAACCAGCCGCTTCAAAGACATCT
TTGATTGTTCGTGCAGCTCACTCAGGCTCAGTGAACCCTCATCTTGCTGAAAAATTAGAG
AAGCTTGGTAATCGCGATGTTGTCGGTTTCGGATGGAACGGAGAACCAACTTACTACGAT
AGGCCAGATTTTCCCATGCCTGCCATTCGTTTTAAGGAAAACACTCCAGATGTTTTGGCT
CTTAGAGCAAAGGAAAAGGAGGACTGGAAGAAGCTGTCGATTCAAGAAAAGAAAGCCCTC
TATCGTGCATCATTCTGTCAGACATTCGCTGAAATGAAATATCCAACAGGAGAATGGAAA
ATGCACTTGGGTAACACACTTATTGTTTTCGCATTAGCAATCTACATTTCACTGTGGATG
GCTGCCTATATCTACGATCCAGATCCCATTTCATTTGATGAAGAACACCAAAAAGCTCAA
CTTAAACGTATGCTTACATTGGAAGTCAATCCTATTCATGGTCTCTCAGCCAATTGGGAC
TATGAAAACAAGAGATGGAAGAAAAGTTATTATTTTCGATTGTTCATTCAATTGAACTAC
AAAATTCAACAGAAAAAAATGTCAAATAAATGTA
>g12311.t9 Gene=g12311 Length=211
MASRMMALALRHQPAASKTSLIVRAAHSGSVNPHLAEKLEKLGNRDVVGFGWNGEPTYYD
RPDFPMPAIRFKENTPDVLALRAKEKEDWKKLSIQEKKALYRASFCQTFAEMKYPTGEWK
MHLGNTLIVFALAIYISLWMAAYIYDPDPISFDEEHQKAQLKRMLTLEVNPIHGLSANWD
YENKRWKKSYYFRLFIQLNYKIQQKKMSNKC
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 13 | g12311.t9 | CDD | cd00922 | Cyt_c_Oxidase_IV | 46 | 181 | 2.45042E-64 |
| 9 | g12311.t9 | Gene3D | G3DSA:1.10.442.10 | Cytochrome C Oxidase | 46 | 188 | 6.0E-59 |
| 2 | g12311.t9 | PANTHER | PTHR10707 | CYTOCHROME C OXIDASE SUBUNIT IV | 5 | 188 | 1.2E-46 |
| 6 | g12311.t9 | PRINTS | PR01873 | Cytochrome c oxidase subunit IV signature | 59 | 72 | 5.0E-21 |
| 4 | g12311.t9 | PRINTS | PR01873 | Cytochrome c oxidase subunit IV signature | 102 | 120 | 5.0E-21 |
| 5 | g12311.t9 | PRINTS | PR01873 | Cytochrome c oxidase subunit IV signature | 143 | 156 | 5.0E-21 |
| 3 | g12311.t9 | PRINTS | PR01873 | Cytochrome c oxidase subunit IV signature | 171 | 187 | 5.0E-21 |
| 1 | g12311.t9 | Pfam | PF02936 | Cytochrome c oxidase subunit IV | 51 | 187 | 3.8E-52 |
| 10 | g12311.t9 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 122 | - |
| 12 | g12311.t9 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 123 | 145 | - |
| 11 | g12311.t9 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 146 | 211 | - |
| 7 | g12311.t9 | SUPERFAMILY | SSF81406 | Mitochondrial cytochrome c oxidase subunit IV | 46 | 188 | 1.09E-56 |
| 8 | g12311.t9 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 17 | - |
| 14 | g12311.t9 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 123 | 145 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004129 | cytochrome-c oxidase activity | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed