General information for g12343.t12
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Annexin B11.
Parent gene
- The parent gene g12343 is located on chr_1: 22649445..22650065 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12343 | g12343.t12 | TSS | g12343.t12 | 22647505 | 22647505 |
| chr_1 | g12343 | g12343.t12 | isoform | g12343.t12 | 22648150 | 22648933 |
| chr_1 | g12343 | g12343.t12 | exon | g12343.t12.exon1 | 22648150 | 22648284 |
| chr_1 | g12343 | g12343.t12 | cds | g12343.t12.CDS1 | 22648249 | 22648284 |
| chr_1 | g12343 | g12343.t12 | exon | g12343.t12.exon2 | 22648513 | 22648588 |
| chr_1 | g12343 | g12343.t12 | cds | g12343.t12.CDS2 | 22648513 | 22648588 |
| chr_1 | g12343 | g12343.t12 | exon | g12343.t12.exon3 | 22648649 | 22648933 |
| chr_1 | g12343 | g12343.t12 | cds | g12343.t12.CDS3 | 22648649 | 22648932 |
| chr_1 | g12343 | g12343.t12 | TTS | g12343.t12 | NA | NA |
Sequences
>g12343.t12 Gene=g12343 Length=496
CCTATTTATCAACATCAACAAAGTAATGCTTCTTCTTATGGAACTCCAAATCAACATCAA
TACCAATCACCTCAATTTCAAATATCACAAAGTACACCAATGTATGGAAGTCAACAAACA
GGACAAATTAAAAAGGGACGTCCAACAGTTACACCAGCATCGAATTTCAATGCTTCTAAT
GATTGTGCTATTTTACGAAAAGCTATGAAAGGATTTGGAACTGATGAAGATGCTATCATT
TCTGTATTATGTCATCGAACTGTTGATCAAAGAATGGAAATTGTTCGTACTTATAAGACA
GCTTATGGCAAAGATCTGCTTAATGATATTCGCTCTGAAACATCAGGAAATTTTGAAAAG
ATCTTGATTGCACTACTTACACCAACAACTGAATTATATTGTCGTGAACTTTATGAAGCA
ATGGCTGGTGCGGGAACTGATGAGGATGTACTCATTGAAGTTATGTGCACAATGTCAAAT
TATGAAATTCGTCAAA
>g12343.t12 Gene=g12343 Length=132
MYGSQQTGQIKKGRPTVTPASNFNASNDCAILRKAMKGFGTDEDAIISVLCHRTVDQRME
IVRTYKTAYGKDLLNDIRSETSGNFEKILIALLTPTTELYCRELYEAMAGAGTDEDVLIE
VMCTMSNYEIRQ
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g12343.t12 | Gene3D | G3DSA:1.10.220.10 | - | 22 | 94 | 8.3E-30 |
| 9 | g12343.t12 | Gene3D | G3DSA:1.10.220.10 | - | 95 | 132 | 1.2E-9 |
| 3 | g12343.t12 | PANTHER | PTHR10502 | ANNEXIN | 13 | 131 | 1.7E-43 |
| 4 | g12343.t12 | PANTHER | PTHR10502:SF226 | ANNEXIN | 13 | 131 | 1.7E-43 |
| 7 | g12343.t12 | PRINTS | PR00196 | Annexin family signature | 37 | 59 | 6.8E-24 |
| 5 | g12343.t12 | PRINTS | PR00196 | Annexin family signature | 77 | 93 | 6.8E-24 |
| 6 | g12343.t12 | PRINTS | PR00196 | Annexin family signature | 104 | 125 | 6.8E-24 |
| 2 | g12343.t12 | Pfam | PF00191 | Annexin | 28 | 92 | 3.5E-26 |
| 1 | g12343.t12 | Pfam | PF00191 | Annexin | 102 | 132 | 9.8E-8 |
| 11 | g12343.t12 | ProSitePatterns | PS00223 | Annexin repeat signature. | 40 | 92 | - |
| 13 | g12343.t12 | ProSiteProfiles | PS51897 | Annexin repeat profile. | 23 | 94 | 29.924 |
| 14 | g12343.t12 | ProSiteProfiles | PS51897 | Annexin repeat profile. | 95 | 132 | 15.725 |
| 12 | g12343.t12 | SMART | SM00335 | annex3 | 40 | 92 | 1.2E-24 |
| 8 | g12343.t12 | SUPERFAMILY | SSF47874 | Annexin | 8 | 131 | 4.06E-46 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005544 | calcium-dependent phospholipid binding | MF |
| GO:0005509 | calcium ion binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed