General information for g12429.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Calcitonin gene-related peptide type 1 receptor.
Parent gene
- The parent gene g12429 is located on chr_1: 23562562..23567783 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12429 | g12429.t1 | isoform | g12429.t1 | 23562562 | 23567783 |
| chr_1 | g12429 | g12429.t1 | exon | g12429.t1.exon1 | 23562562 | 23562576 |
| chr_1 | g12429 | g12429.t1 | cds | g12429.t1.CDS1 | 23562562 | 23562576 |
| chr_1 | g12429 | g12429.t1 | exon | g12429.t1.exon2 | 23562843 | 23562965 |
| chr_1 | g12429 | g12429.t1 | cds | g12429.t1.CDS2 | 23562843 | 23562965 |
| chr_1 | g12429 | g12429.t1 | exon | g12429.t1.exon3 | 23563679 | 23563707 |
| chr_1 | g12429 | g12429.t1 | cds | g12429.t1.CDS3 | 23563679 | 23563707 |
| chr_1 | g12429 | g12429.t1 | exon | g12429.t1.exon4 | 23563787 | 23563881 |
| chr_1 | g12429 | g12429.t1 | cds | g12429.t1.CDS4 | 23563787 | 23563881 |
| chr_1 | g12429 | g12429.t1 | exon | g12429.t1.exon5 | 23565238 | 23565423 |
| chr_1 | g12429 | g12429.t1 | cds | g12429.t1.CDS5 | 23565238 | 23565423 |
| chr_1 | g12429 | g12429.t1 | exon | g12429.t1.exon6 | 23565495 | 23565721 |
| chr_1 | g12429 | g12429.t1 | cds | g12429.t1.CDS6 | 23565495 | 23565721 |
| chr_1 | g12429 | g12429.t1 | exon | g12429.t1.exon7 | 23567688 | 23567783 |
| chr_1 | g12429 | g12429.t1 | cds | g12429.t1.CDS7 | 23567688 | 23567783 |
| chr_1 | g12429 | g12429.t1 | TSS | g12429.t1 | NA | NA |
| chr_1 | g12429 | g12429.t1 | TTS | g12429.t1 | NA | NA |
Sequences
>g12429.t1 Gene=g12429 Length=771
ATGAATTTATTTGCATCGTTTGCAGCAAATAACTTCTTGTGGCTGATATGGTATCATGTT
ATTTTAGATACGAATGTTTTGGACACAGATAGTCAGACCGGCTGCGTGCTACTTCATTTA
ATTCTCCATTATTTCCTTCTGACCAATTATGCATGGATGTTATGCGAAGGTTTCTACCTT
CATACGGTGCTTGTGTCAGCATTTATATCAGAGCAGAAACTTGTACGATGGCTCATAGTG
CTAGGTTGGAGTTCACCCGCGATATTTTTAATACTTTATGGAATACTTCGTGGCTATGTG
AGCGAGGAACATGACCGGGCTTTATGTTGGATGAATGAAAGTCCATATTCAAACGTGCTA
GTCGCTCCAGTATGCTTATCTATGTTACTTAATCTTCTCTTCTTGTGCAATATTGTACGT
GTTGTATTGCTAAAACTTCGAGCGCCTGCTTCTGTCTCGAATGGTGGACCGGGCACAGGA
CCATCAAGAAATATACTTCAGGCATTTCGTGCAACTTTACTGCTCGTTCCGCTGCTCGGC
CTTCAATATATCCTAACGCCATTCAGGCCTGGAAAAAATCATCCCTATGAAGCGACATAC
GAAATTATTTCTGCATTTACGGCATCATTTCAGGGTTTGTGCGTAGCAACGCTATTTTGT
TTCTGTAATGGTGAAGTAATAGCACAGGTGAAACGACGTTGGCGAATAGCATTTTTTCGG
CCTCGAGCAAACAGCTATACAGCGACTCAAGTTTCGAGTTTTCTTCCTTAA
>g12429.t1 Gene=g12429 Length=256
MNLFASFAANNFLWLIWYHVILDTNVLDTDSQTGCVLLHLILHYFLLTNYAWMLCEGFYL
HTVLVSAFISEQKLVRWLIVLGWSSPAIFLILYGILRGYVSEEHDRALCWMNESPYSNVL
VAPVCLSMLLNLLFLCNIVRVVLLKLRAPASVSNGGPGTGPSRNILQAFRATLLLVPLLG
LQYILTPFRPGKNHPYEATYEIISAFTASFQGLCVATLFCFCNGEVIAQVKRRWRIAFFR
PRANSYTATQVSSFLP
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g12429.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 1 | 249 | 1.4E-58 |
| 2 | g12429.t1 | PANTHER | PTHR45620 | PDF RECEPTOR-LIKE PROTEIN-RELATED | 1 | 252 | 3.5E-126 |
| 3 | g12429.t1 | PANTHER | PTHR45620:SF32 | DIURETIC HORMONE 31 RECEPTOR, ISOFORM C | 1 | 252 | 3.5E-126 |
| 7 | g12429.t1 | PRINTS | PR00249 | Secretin-like GPCR superfamily signature | 37 | 60 | 1.0E-33 |
| 6 | g12429.t1 | PRINTS | PR00249 | Secretin-like GPCR superfamily signature | 75 | 100 | 1.0E-33 |
| 5 | g12429.t1 | PRINTS | PR00249 | Secretin-like GPCR superfamily signature | 118 | 143 | 1.0E-33 |
| 8 | g12429.t1 | PRINTS | PR00249 | Secretin-like GPCR superfamily signature | 168 | 188 | 1.0E-33 |
| 4 | g12429.t1 | PRINTS | PR00249 | Secretin-like GPCR superfamily signature | 201 | 222 | 1.0E-33 |
| 1 | g12429.t1 | Pfam | PF00002 | 7 transmembrane receptor (Secretin family) | 1 | 215 | 3.4E-44 |
| 16 | g12429.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 49 | - |
| 18 | g12429.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 70 | - |
| 13 | g12429.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 71 | 76 | - |
| 21 | g12429.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 77 | 100 | - |
| 15 | g12429.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 101 | 119 | - |
| 20 | g12429.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 120 | 143 | - |
| 12 | g12429.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 144 | 163 | - |
| 19 | g12429.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 164 | 185 | - |
| 14 | g12429.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 186 | 204 | - |
| 17 | g12429.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 205 | 228 | - |
| 11 | g12429.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 229 | 256 | - |
| 28 | g12429.t1 | ProSiteProfiles | PS50261 | G-protein coupled receptors family 2 profile 2. | 1 | 223 | 31.042 |
| 9 | g12429.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 24 | 242 | 2.84E-5 |
| 23 | g12429.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 2 | 21 | - |
| 22 | g12429.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 36 | 53 | - |
| 25 | g12429.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 96 | - |
| 26 | g12429.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 116 | 138 | - |
| 24 | g12429.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 168 | 187 | - |
| 27 | g12429.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 202 | 224 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004888 | transmembrane signaling receptor activity | MF |
| GO:0007166 | cell surface receptor signaling pathway | BP |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
- This transcript has been annotated with K04577 (calcitonin receptor-like)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed