General information for g12431.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g12431 is located on chr_1: 23574441..23575319 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12431 | g12431.t1 | isoform | g12431.t1 | 23574441 | 23575319 |
| chr_1 | g12431 | g12431.t1 | exon | g12431.t1.exon1 | 23574441 | 23574536 |
| chr_1 | g12431 | g12431.t1 | cds | g12431.t1.CDS1 | 23574441 | 23574536 |
| chr_1 | g12431 | g12431.t1 | exon | g12431.t1.exon2 | 23574592 | 23574698 |
| chr_1 | g12431 | g12431.t1 | cds | g12431.t1.CDS2 | 23574592 | 23574698 |
| chr_1 | g12431 | g12431.t1 | exon | g12431.t1.exon3 | 23575199 | 23575319 |
| chr_1 | g12431 | g12431.t1 | cds | g12431.t1.CDS3 | 23575199 | 23575319 |
| chr_1 | g12431 | g12431.t1 | TSS | g12431.t1 | NA | NA |
| chr_1 | g12431 | g12431.t1 | TTS | g12431.t1 | NA | NA |
Sequences
>g12431.t1 Gene=g12431 Length=324
ATGTCTTCTTCAACATCAACTTCATCGCCTGTAACAATCGACCCACATTCAGAATTTCTC
TTTCAACGAAAACTCGAGTTTGATGACTATCTGAGTAAATTGACGCCACAGCATGAGCCA
GGATTTGCACATAAAATATGTGAGAGTGATTCAACCTGGTTCAAACATCCTGACACAAAC
AGATCATGGACTAACTATACGACGTGCATAGATGTGCAGGATTTTGAGCTGAGACGACAA
ATAAATCTAATTTATATAACAGGATATACAATATCACTCATTGCAATTCTTCTTTCCATT
TCTATATTTTGCTATTTCAGGTAA
>g12431.t1 Gene=g12431 Length=107
MSSSTSTSSPVTIDPHSEFLFQRKLEFDDYLSKLTPQHEPGFAHKICESDSTWFKHPDTN
RSWTNYTTCIDVQDFELRRQINLIYITGYTISLIAILLSISIFCYFR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g12431.t1 | Gene3D | G3DSA:4.10.1240.10 | Hormone receptor superfamily | 26 | 74 | 1.3E-9 |
| 1 | g12431.t1 | PANTHER | PTHR45620 | PDF RECEPTOR-LIKE PROTEIN-RELATED | 17 | 107 | 1.3E-23 |
| 2 | g12431.t1 | PANTHER | PTHR45620:SF32 | DIURETIC HORMONE 31 RECEPTOR, ISOFORM C | 17 | 107 | 1.3E-23 |
| 7 | g12431.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 82 | - |
| 8 | g12431.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 106 | - |
| 6 | g12431.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 107 | 107 | - |
| 4 | g12431.t1 | SUPERFAMILY | SSF111418 | Hormone receptor domain | 30 | 75 | 1.44E-5 |
| 3 | g12431.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 106 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed