General information for g12552.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g12552 is located on chr_1: 24372717..24373300 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12552 | g12552.t3 | isoform | g12552.t3 | 24372717 | 24373300 |
| chr_1 | g12552 | g12552.t3 | exon | g12552.t3.exon1 | 24372717 | 24373300 |
| chr_1 | g12552 | g12552.t3 | cds | g12552.t3.CDS1 | 24372956 | 24373300 |
| chr_1 | g12552 | g12552.t3 | TTS | g12552.t3 | 24373345 | 24373345 |
| chr_1 | g12552 | g12552.t3 | TSS | g12552.t3 | NA | NA |
Sequences
>g12552.t3 Gene=g12552 Length=584
AGAAAAAGAAACTTCAATATTGTCCATTATGCACGAAAGAATATGACTACAAGAAGCAAC
TTAATGATCATATTCGTTCATTTCACAAGAAAGAGAGAAATACTCAATGCGATATATGCA
ACAGAAAATTCTATCATCGTGATTTAAAGAAGCACATTGAGCATGTTCATGGAGAAAAGA
CATTAACTTGTGAAGTTTGCGGTCGTAAATATTCTTGCTATGACAATCTCAAATTGCATA
TGCGTTATCATCAAGTTCCAAAATATATTTGCAAAGTTGAAGGATGTGGAAAAAGATTTC
ATCAAAAATCATTGTTAGAACATCACAAAGTAAAACATACGGATAAGAAACAAATTGAAT
GCAAAGAATGTAGCAGTAATTTCTTCACTATTCGTGATCTCAAACGTCATGTTCAGCGTG
TGCATGAGAAAGTATATCGACAGTGTGCTGTGTGTGAAATGACTTTCTGCCGTAAGGATA
AATATCGCGAACATATTCTCAAATCACATAAAAATTTACCCGTGAATGAACGTGATTCTA
TTTTGGATGAAATTAAGAAACTTAATTGGTATGAGAAGGAATAA
>g12552.t3 Gene=g12552 Length=114
MRYHQVPKYICKVEGCGKRFHQKSLLEHHKVKHTDKKQIECKECSSNFFTIRDLKRHVQR
VHEKVYRQCAVCEMTFCRKDKYREHILKSHKNLPVNERDSILDEIKKLNWYEKE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g12552.t3 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 9 | 33 | 5.7E-7 |
| 11 | g12552.t3 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 34 | 99 | 2.4E-9 |
| 3 | g12552.t3 | PANTHER | PTHR24404 | ZINC FINGER PROTEIN | 8 | 87 | 6.1E-12 |
| 2 | g12552.t3 | Pfam | PF00096 | Zinc finger, C2H2 type | 9 | 33 | 0.0021 |
| 1 | g12552.t3 | Pfam | PF00096 | Zinc finger, C2H2 type | 68 | 90 | 0.0099 |
| 8 | g12552.t3 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 11 | 33 | - |
| 9 | g12552.t3 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 41 | 62 | - |
| 10 | g12552.t3 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 69 | 90 | - |
| 14 | g12552.t3 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 9 | 38 | 12.321 |
| 13 | g12552.t3 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 39 | 62 | 9.162 |
| 6 | g12552.t3 | SMART | SM00355 | c2h2final6 | 9 | 33 | 0.0066 |
| 7 | g12552.t3 | SMART | SM00355 | c2h2final6 | 39 | 62 | 0.14 |
| 5 | g12552.t3 | SMART | SM00355 | c2h2final6 | 67 | 90 | 0.55 |
| 4 | g12552.t3 | SUPERFAMILY | SSF57667 | beta-beta-alpha zinc fingers | 9 | 59 | 9.34E-10 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
