General information for g12731.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Aldo-keto reductase family 1 member B1.
Parent gene
- The parent gene g12731 is located on chr_1: 25513339..25514140 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12731 | g12731.t1 | isoform | g12731.t1 | 25513339 | 25514140 |
| chr_1 | g12731 | g12731.t1 | exon | g12731.t1.exon1 | 25513339 | 25513554 |
| chr_1 | g12731 | g12731.t1 | cds | g12731.t1.CDS1 | 25513339 | 25513554 |
| chr_1 | g12731 | g12731.t1 | exon | g12731.t1.exon2 | 25513712 | 25513840 |
| chr_1 | g12731 | g12731.t1 | cds | g12731.t1.CDS2 | 25513712 | 25513840 |
| chr_1 | g12731 | g12731.t1 | exon | g12731.t1.exon3 | 25514005 | 25514015 |
| chr_1 | g12731 | g12731.t1 | cds | g12731.t1.CDS3 | 25514005 | 25514015 |
| chr_1 | g12731 | g12731.t1 | exon | g12731.t1.exon4 | 25514080 | 25514140 |
| chr_1 | g12731 | g12731.t1 | cds | g12731.t1.CDS4 | 25514080 | 25514140 |
| chr_1 | g12731 | g12731.t1 | TSS | g12731.t1 | 25514191 | 25514191 |
| chr_1 | g12731 | g12731.t1 | TTS | g12731.t1 | NA | NA |
Sequences
>g12731.t1 Gene=g12731 Length=417
ATGTCATCAGTTCGTACTTTAGTTTTGATAATAGAAAGAAAAATTCCCACTGTTGGTTTA
GGTACATGGAATTCACCACCTGGTGTTGTTGCTCAAGCTGTAAAAGATGCAATTGATGCT
GGCTATCGTCATATTGATTGTGCTCATTGCTATCAAATGAACATGAAGTTGGTGAAGGAA
TCAATGCCAAAATCGCTGAAGTCGGATGAAATTTTTCCAAGAGATTCAAATGGAAAAATT
TTGCATTCAAGAGTTGATTTTGTTGACACTTATCGTGCAATGGAATATCTTGTTGATGAT
GGTTTAGCAAAAAGTATTGGAGTGTCAAATTTTAATATTCAACAACTTGAGTATATCTCA
AGAATGCTCGTATTCAACCAGTCACTAATCAAATTGAATGCCATCCATATTTGTTAA
>g12731.t1 Gene=g12731 Length=138
MSSVRTLVLIIERKIPTVGLGTWNSPPGVVAQAVKDAIDAGYRHIDCAHCYQMNMKLVKE
SMPKSLKSDEIFPRDSNGKILHSRVDFVDTYRAMEYLVDDGLAKSIGVSNFNIQQLEYIS
RMLVFNQSLIKLNAIHIC
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g12731.t1 | Gene3D | G3DSA:3.20.20.100 | - | 6 | 65 | 1.7E-15 |
| 8 | g12731.t1 | Gene3D | G3DSA:3.20.20.100 | - | 66 | 131 | 2.0E-15 |
| 3 | g12731.t1 | PANTHER | PTHR11732:SF294 | ALDO-KETO REDUCTASE FAMILY 1 MEMBER B1 | 7 | 67 | 1.2E-28 |
| 5 | g12731.t1 | PANTHER | PTHR11732 | ALDO/KETO REDUCTASE | 7 | 67 | 1.2E-28 |
| 2 | g12731.t1 | PANTHER | PTHR11732:SF294 | ALDO-KETO REDUCTASE FAMILY 1 MEMBER B1 | 62 | 119 | 1.2E-28 |
| 4 | g12731.t1 | PANTHER | PTHR11732 | ALDO/KETO REDUCTASE | 62 | 119 | 1.2E-28 |
| 1 | g12731.t1 | Pfam | PF00248 | Aldo/keto reductase family | 87 | 119 | 1.1E-5 |
| 7 | g12731.t1 | ProSitePatterns | PS00062 | Aldo/keto reductase family signature 2. | 94 | 111 | - |
| 6 | g12731.t1 | SUPERFAMILY | SSF51430 | NAD(P)-linked oxidoreductase | 14 | 127 | 1.11E-25 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0047834 | D-threo-aldose 1-dehydrogenase activity | MF |
| GO:0055114 | NA | NA |
| GO:0016491 | oxidoreductase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed