| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12840 | g12840.t6 | TTS | g12840.t6 | 26499912 | 26499912 |
| chr_1 | g12840 | g12840.t6 | isoform | g12840.t6 | 26500001 | 26501395 |
| chr_1 | g12840 | g12840.t6 | exon | g12840.t6.exon1 | 26500001 | 26500213 |
| chr_1 | g12840 | g12840.t6 | cds | g12840.t6.CDS1 | 26500001 | 26500213 |
| chr_1 | g12840 | g12840.t6 | exon | g12840.t6.exon2 | 26500283 | 26500322 |
| chr_1 | g12840 | g12840.t6 | cds | g12840.t6.CDS2 | 26500283 | 26500322 |
| chr_1 | g12840 | g12840.t6 | exon | g12840.t6.exon3 | 26500382 | 26500525 |
| chr_1 | g12840 | g12840.t6 | cds | g12840.t6.CDS3 | 26500382 | 26500525 |
| chr_1 | g12840 | g12840.t6 | exon | g12840.t6.exon4 | 26500583 | 26500839 |
| chr_1 | g12840 | g12840.t6 | cds | g12840.t6.CDS4 | 26500583 | 26500824 |
| chr_1 | g12840 | g12840.t6 | exon | g12840.t6.exon5 | 26501124 | 26501395 |
| chr_1 | g12840 | g12840.t6 | TSS | g12840.t6 | 26501969 | 26501969 |
>g12840.t6 Gene=g12840 Length=926
ATGAAAGTTTTGAGAGGATGCTTGCTGCTTGGATGGGATTTGAGCGTGAGGATTTACATT
CTTATCATACTCATTCCAATTCTTTTTATCGGACAAATCAGAAGTTTAAAGTTCCTTGTG
CCATTCTCAGGAAGTGCAAATGTTTTCATTGTTGTTGTGTTTGCAATTGTACTTTACTAT
ATCTTCAAGGAACCACTAGATATAAGTGATAAGCCAAGTATTGTTAGTTGGACTAAATGG
CCTGTTTTCTTCAGGTAAATTTATGGCTTTAAGGTATCGGTGCAGTCATGCCTGTTGAAA
ATTCTATGGAAAAACCACAACAATTTCTTGGTTATCCGTCCGTACTTCTAATTGCTATGA
TTATCGTCACTGTTATGTATGCTGTCATCGGTTTCCTCGGCTTTGTACGATTTGGTGATG
AAATAAGAGGATCAATTACACTCAATTTACCAACAGATGAATGGCCAGCAGTCACTGGAC
AATCACTCATTGGTATTGCTATTTTACTCACATTTGGTCTTCAATTTTACATTCCAATGG
ACATTCTATTGAGAAAACTTGAAAATAGAATTGCAAAGAAAAGAAATATTTCAGAAATTG
CAATTAGAACCGGTATTATGCTTGCGATGGGAGCAGTAGCAATAGCAGTTCCTGATCTTG
AACCTGTTATCAGTCTTGTCGGTGCTGTTTTCTTCAGCAGCTTGGGTATTTTCGTTCCTG
CTTTTATCGAGATTGTATTTTTGTCTTCATATGAAGGCTACGGAGCTTTGAAATGGAAAT
TATGGAAAAACATTTTGCTCATGATTTTTTCACTTGTCGCCATGTTTGCAGGAGCATTTG
TATCGATTTTAGATATCATTGAAACGTATACTGGTGGAAGTCATGAAGAAAAGAAATTAG
CCATTCTTTCCAGCCCTCTAGATTAA
>g12840.t6 Gene=g12840 Length=212
MPVENSMEKPQQFLGYPSVLLIAMIIVTVMYAVIGFLGFVRFGDEIRGSITLNLPTDEWP
AVTGQSLIGIAILLTFGLQFYIPMDILLRKLENRIAKKRNISEIAIRTGIMLAMGAVAIA
VPDLEPVISLVGAVFFSSLGIFVPAFIEIVFLSSYEGYGALKWKLWKNILLMIFSLVAMF
AGAFVSILDIIETYTGGSHEEKKLAILSSPLD
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g12840.t6 | PANTHER | PTHR22950:SF494 | GH04538P | 1 | 195 | 1.3E-64 |
| 3 | g12840.t6 | PANTHER | PTHR22950 | AMINO ACID TRANSPORTER | 1 | 195 | 1.3E-64 |
| 1 | g12840.t6 | Pfam | PF01490 | Transmembrane amino acid transporter protein | 2 | 187 | 1.3E-32 |
| 11 | g12840.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 19 | - |
| 16 | g12840.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 42 | - |
| 13 | g12840.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 43 | 61 | - |
| 15 | g12840.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 83 | - |
| 10 | g12840.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 84 | 103 | - |
| 19 | g12840.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 104 | 121 | - |
| 12 | g12840.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 122 | 126 | - |
| 18 | g12840.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 127 | 153 | - |
| 9 | g12840.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 154 | 164 | - |
| 17 | g12840.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 165 | 188 | - |
| 14 | g12840.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 189 | 212 | - |
| 5 | g12840.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 35 | - |
| 7 | g12840.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 61 | 83 | - |
| 8 | g12840.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 104 | 121 | - |
| 4 | g12840.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 131 | 153 | - |
| 6 | g12840.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 165 | 187 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed