General information for g12841.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g12841 is located on chr_1: 26502365..26502640 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12841 | g12841.t1 | TTS | g12841.t1 | 26502085 | 26502085 |
| chr_1 | g12841 | g12841.t1 | isoform | g12841.t1 | 26502365 | 26502640 |
| chr_1 | g12841 | g12841.t1 | exon | g12841.t1.exon1 | 26502365 | 26502509 |
| chr_1 | g12841 | g12841.t1 | cds | g12841.t1.CDS1 | 26502365 | 26502509 |
| chr_1 | g12841 | g12841.t1 | exon | g12841.t1.exon2 | 26502567 | 26502640 |
| chr_1 | g12841 | g12841.t1 | cds | g12841.t1.CDS2 | 26502567 | 26502640 |
| chr_1 | g12841 | g12841.t1 | TSS | g12841.t1 | 26502735 | 26502735 |
Sequences
>g12841.t1 Gene=g12841 Length=219
ATGAATCAACAAGGTCAATATGAAAATCCTGTTCCTGGAACTGTTATCGATAATACTATT
ACATTACCACAACGTTACGAAATCTTTTTAGTGAGTCAAACGTTCGTGAAGGCACTGTAT
CTTCAACCAATTATAATATCATCTTTGATATTTTTTGGCTTACAAGCTGATAGATTACAA
CATTTCACACATAAATTGACTCACCTTTATTACAATTGA
>g12841.t1 Gene=g12841 Length=72
MNQQGQYENPVPGTVIDNTITLPQRYEIFLVSQTFVKALYLQPIIISSLIFFGLQADRLQ
HFTHKLTHLYYN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g12841.t1 | Gene3D | G3DSA:3.30.420.10 | - | 1 | 72 | 7.2E-10 |
| 1 | g12841.t1 | Pfam | PF02171 | Piwi domain | 5 | 72 | 7.5E-10 |
| 6 | g12841.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 38 | - |
| 7 | g12841.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 39 | 56 | - |
| 5 | g12841.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 57 | 72 | - |
| 3 | g12841.t1 | SUPERFAMILY | SSF53098 | Ribonuclease H-like | 3 | 72 | 1.06E-6 |
| 2 | g12841.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 34 | 56 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003676 | nucleic acid binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
