General information for g1286.t22
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Transmembrane emp24 domain-containing protein bai.
Parent gene
- The parent gene g1286 is located on chr_3: 9431414..9431695 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1286 | g1286.t22 | TSS | g1286.t22 | 9430319 | 9430319 |
| chr_3 | g1286 | g1286.t22 | isoform | g1286.t22 | 9430644 | 9431531 |
| chr_3 | g1286 | g1286.t22 | exon | g1286.t22.exon1 | 9430644 | 9430811 |
| chr_3 | g1286 | g1286.t22 | exon | g1286.t22.exon2 | 9430869 | 9430939 |
| chr_3 | g1286 | g1286.t22 | exon | g1286.t22.exon3 | 9431228 | 9431354 |
| chr_3 | g1286 | g1286.t22 | cds | g1286.t22.CDS1 | 9431318 | 9431354 |
| chr_3 | g1286 | g1286.t22 | exon | g1286.t22.exon4 | 9431413 | 9431531 |
| chr_3 | g1286 | g1286.t22 | cds | g1286.t22.CDS2 | 9431413 | 9431531 |
| chr_3 | g1286 | g1286.t22 | TTS | g1286.t22 | 9431763 | 9431763 |
Sequences
>g1286.t22 Gene=g1286 Length=485
GAGAATATGAAGTGTCACAAGCTCCCGGACAAGTAATTGATTATGAAGTCCGTGATACAA
AGCAACACATTTTGTCTAAAAAGGAAGATATCTCAAGAGGAAAGTTTAGTTTCACATCAG
AAGTTTTTGATGTTTATGAGTTATGTTTTATCTCAAAAGTTCCACACAACGTTCGTGGTA
TTGTTCAAGAAATAAATATCAATATTAAAAAAGGTGTTGAGACAAAATCATATGAAGGCA
TCGCTGAAGCAGCCAAATTGAAGCCACTTGAATTAGAGCTTAAGAAGCTCGAAGATCTTT
CAGATGCCATTGTTCAAGATTTTGCGTTAATGAGAAAACGTGAAGAAGAAATGAGAGATA
CAAATGAATCAACAAACAATAGAGTTTTATTCTTCAGTATATTTGGAATGTGCTGTCTTT
TAGGACTCGCTACATGGCAAGTGCTTTATCTTAGAAGATATTTCATTGCTAAGAAGCTCA
TTTGA
>g1286.t22 Gene=g1286 Length=51
MRKREEEMRDTNESTNNRVLFFSIFGMCCLLGLATWQVLYLRRYFIAKKLI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g1286.t22 | PANTHER | PTHR22811:SF183 | TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEIN 10 | 1 | 50 | 5.3E-22 |
| 3 | g1286.t22 | PANTHER | PTHR22811 | TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEIN | 1 | 50 | 5.3E-22 |
| 1 | g1286.t22 | Pfam | PF01105 | emp24/gp25L/p24 family/GOLD | 1 | 45 | 1.0E-15 |
| 6 | g1286.t22 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
| 7 | g1286.t22 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 41 | - |
| 5 | g1286.t22 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 42 | 51 | - |
| 4 | g1286.t22 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 19 | 41 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
