| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1286 | g1286.t6 | TSS | g1286.t6 | 9430319 | 9430319 |
| chr_3 | g1286 | g1286.t6 | isoform | g1286.t6 | 9430438 | 9430871 |
| chr_3 | g1286 | g1286.t6 | exon | g1286.t6.exon1 | 9430438 | 9430574 |
| chr_3 | g1286 | g1286.t6 | cds | g1286.t6.CDS1 | 9430438 | 9430574 |
| chr_3 | g1286 | g1286.t6 | exon | g1286.t6.exon2 | 9430645 | 9430811 |
| chr_3 | g1286 | g1286.t6 | cds | g1286.t6.CDS2 | 9430645 | 9430811 |
| chr_3 | g1286 | g1286.t6 | exon | g1286.t6.exon3 | 9430869 | 9430871 |
| chr_3 | g1286 | g1286.t6 | cds | g1286.t6.CDS3 | 9430869 | 9430870 |
| chr_3 | g1286 | g1286.t6 | TTS | g1286.t6 | 9431763 | 9431763 |
>g1286.t6 Gene=g1286 Length=307
ATGAAAACAAAAGTGGGATTAGTCGTTTTAGGCTTAATTTGCTTATTTGCAAACGTAAGA
GCAATTCGATTTAATTTGCAGCCAAATACACAAAAATGTTTAAGAGATGAAATAAATGCA
AATGTTTTGGTTGTTGGAGAATATGAAGTGTCACAAGCTCCCGGACAAGTAATTGATTAT
GAAGTCCGTGATACAAAGCAACACATTTTGTCTAAAAAGGAAGATATCTCAAGAGGAAAG
TTTAGTTTCACATCAGAAGTTTTTGATGTTTATGAGTTATGTTTTATCTCAAAAGTTCCA
CACAACG
>g1286.t6 Gene=g1286 Length=102
MKTKVGLVVLGLICLFANVRAIRFNLQPNTQKCLRDEINANVLVVGEYEVSQAPGQVIDY
EVRDTKQHILSKKEDISRGKFSFTSEVFDVYELCFISKVPHN
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g1286.t6 | PANTHER | PTHR22811:SF183 | TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEIN 10 | 16 | 98 | 4.1E-15 |
| 3 | g1286.t6 | PANTHER | PTHR22811 | TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEIN | 16 | 98 | 4.1E-15 |
| 1 | g1286.t6 | Pfam | PF01105 | emp24/gp25L/p24 family/GOLD | 21 | 97 | 1.9E-13 |
| 8 | g1286.t6 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 21 | - |
| 9 | g1286.t6 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 4 | - |
| 10 | g1286.t6 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 5 | 16 | - |
| 11 | g1286.t6 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 17 | 21 | - |
| 7 | g1286.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 22 | 102 | - |
| 6 | g1286.t6 | ProSiteProfiles | PS50866 | GOLD domain profile. | 31 | 102 | 13.406 |
| 5 | g1286.t6 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 21 | - |
| 4 | g1286.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 5 | 22 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.