General information for g12912.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Fatty acid hydroxylase domain-containing protein 2.
Parent gene
- The parent gene g12912 is located on chr_1: 26869142..26870470 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12912 | g12912.t1 | TSS | g12912.t1 | 26866428 | 26866428 |
| chr_1 | g12912 | g12912.t1 | isoform | g12912.t1 | 26866454 | 26869142 |
| chr_1 | g12912 | g12912.t1 | exon | g12912.t1.exon1 | 26866454 | 26866671 |
| chr_1 | g12912 | g12912.t1 | cds | g12912.t1.CDS1 | 26866454 | 26866671 |
| chr_1 | g12912 | g12912.t1 | exon | g12912.t1.exon2 | 26867855 | 26867928 |
| chr_1 | g12912 | g12912.t1 | cds | g12912.t1.CDS2 | 26867855 | 26867928 |
| chr_1 | g12912 | g12912.t1 | exon | g12912.t1.exon3 | 26867984 | 26868279 |
| chr_1 | g12912 | g12912.t1 | cds | g12912.t1.CDS3 | 26867984 | 26868279 |
| chr_1 | g12912 | g12912.t1 | exon | g12912.t1.exon4 | 26868340 | 26868460 |
| chr_1 | g12912 | g12912.t1 | cds | g12912.t1.CDS4 | 26868340 | 26868460 |
| chr_1 | g12912 | g12912.t1 | exon | g12912.t1.exon5 | 26868518 | 26868731 |
| chr_1 | g12912 | g12912.t1 | cds | g12912.t1.CDS5 | 26868518 | 26868731 |
| chr_1 | g12912 | g12912.t1 | exon | g12912.t1.exon6 | 26868986 | 26869142 |
| chr_1 | g12912 | g12912.t1 | cds | g12912.t1.CDS6 | 26868986 | 26869142 |
| chr_1 | g12912 | g12912.t1 | TTS | g12912.t1 | 26869496 | 26869496 |
Sequences
>g12912.t1 Gene=g12912 Length=1080
ATGGATGTAAGTAGTGAGCCGAGTTGTTCATCGCAATCAGAGAAAATTGTCAAGTGCACT
CGTCGACATCAGGATGATACAGATGAAGAAGAAGAAGAAATAAAACATCGCAGGCATAAT
GTGCCTTCTTCCAAATTATCAACATCAATCTATGAGTATTTGGTGTTGATTTCAATCATT
CTTATCATCTTTGCTGCTTTTCGAAATTCAGTGACCTGGCACTTGCAAGTATTTTGGAAT
CGATCTGCTGACTTGTGGCAACACTTGTGGGATCAATTTTTGGATTATGCAGGAGAAGAT
GAATTCACATTATTTGTATGGTGGACAACAATTTACACTTTTTGTATTTATTGGTTTTTT
GGGGCCATCTACACAATTTTAGACATCACAAACAAACCAAAGTTTATTAGAAAATATAAA
ATTCAACCAAATACAAATGAACCATTGGATAAGAAAAAATTGCGCCGAGTGATTTTACAA
GTGATCTTCAATCAAATTTTTGTTGGCGTTCCATTCGCAATTTTTTCTTATTACGCGCTA
AAATTCAGAGGCTTTCCTGAAATTCGTGAACTTCCAACTTTTCATTGGGTCCTATTTGAG
CTTGGAATTTGTATTTTAGTGGAAGAATTTGGTTTTTATTATTCGCATAGATTTTTACAC
AGCAAGCACATTTATAAAAGAATTCATAAGAAACATCATGAATGGCAAGCACCAGTCGCT
GTAACTGCCATTTATGCCCATCCTATTGAACACATTTTTAGCAACATTCTTCCGCCTTTC
CTTGGTGTCTTCATTTGTCGATCACATCTCGCAACAAGCTGGCTCTGGTTTACAATGGCA
TTGCTTTCTACTTTAAACGCTCATTCAGGCTATCATTTCCCGTTTTTTCCATCTCCTGAA
GCGCATGATTTTCACCATTTCAAATTCAATTACAACTTTGGAATGCTTGGATTATTGGAT
AGAGTACATGGAACTGATTCACTATTTAGAATGTCTCCACAAGGACAACGACATTTAATG
CTTCTCTCATTTATTCCAGCACATGAGCAATTTCCTGATAAACCAAAAAAATCATCGTAA
>g12912.t1 Gene=g12912 Length=359
MDVSSEPSCSSQSEKIVKCTRRHQDDTDEEEEEIKHRRHNVPSSKLSTSIYEYLVLISII
LIIFAAFRNSVTWHLQVFWNRSADLWQHLWDQFLDYAGEDEFTLFVWWTTIYTFCIYWFF
GAIYTILDITNKPKFIRKYKIQPNTNEPLDKKKLRRVILQVIFNQIFVGVPFAIFSYYAL
KFRGFPEIRELPTFHWVLFELGICILVEEFGFYYSHRFLHSKHIYKRIHKKHHEWQAPVA
VTAIYAHPIEHIFSNILPPFLGVFICRSHLATSWLWFTMALLSTLNAHSGYHFPFFPSPE
AHDFHHFKFNYNFGMLGLLDRVHGTDSLFRMSPQGQRHLMLLSFIPAHEQFPDKPKKSS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g12912.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 36 | - |
| 10 | g12912.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 15 | - |
| 8 | g12912.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 16 | 36 | - |
| 2 | g12912.t1 | PANTHER | PTHR11863:SF26 | FATTY ACID HYDROXYLASE DOMAIN-CONTAINING PROTEIN 2 | 72 | 353 | 5.7E-106 |
| 3 | g12912.t1 | PANTHER | PTHR11863 | STEROL DESATURASE | 72 | 353 | 5.7E-106 |
| 1 | g12912.t1 | Pfam | PF04116 | Fatty acid hydroxylase superfamily | 203 | 325 | 4.1E-23 |
| 14 | g12912.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 49 | - |
| 23 | g12912.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 67 | - |
| 17 | g12912.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 68 | 104 | - |
| 20 | g12912.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 127 | - |
| 12 | g12912.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 128 | 156 | - |
| 22 | g12912.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 157 | 179 | - |
| 16 | g12912.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 180 | 193 | - |
| 19 | g12912.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 194 | 214 | - |
| 13 | g12912.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 215 | 234 | - |
| 18 | g12912.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 235 | 254 | - |
| 15 | g12912.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 255 | 259 | - |
| 21 | g12912.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 260 | 282 | - |
| 11 | g12912.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 283 | 359 | - |
| 6 | g12912.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 46 | 68 | - |
| 4 | g12912.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 127 | - |
| 5 | g12912.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 157 | 179 | - |
| 7 | g12912.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 194 | 216 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005506 | iron ion binding | MF |
| GO:0055114 | NA | NA |
| GO:0016491 | oxidoreductase activity | MF |
| GO:0008610 | lipid biosynthetic process | BP |
KEGG
Orthology
- This transcript has been annotated with K22282 (fatty acid hydroxylase domain-containing protein 2)
Pathway
This gene does not belong to any pathways.
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
