| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12937 | g12937.t4 | TTS | g12937.t4 | 27009496 | 27009496 |
| chr_1 | g12937 | g12937.t4 | isoform | g12937.t4 | 27009648 | 27010514 |
| chr_1 | g12937 | g12937.t4 | exon | g12937.t4.exon1 | 27009648 | 27009871 |
| chr_1 | g12937 | g12937.t4 | cds | g12937.t4.CDS1 | 27009648 | 27009871 |
| chr_1 | g12937 | g12937.t4 | exon | g12937.t4.exon2 | 27009934 | 27009999 |
| chr_1 | g12937 | g12937.t4 | cds | g12937.t4.CDS2 | 27009934 | 27009999 |
| chr_1 | g12937 | g12937.t4 | exon | g12937.t4.exon3 | 27010138 | 27010514 |
| chr_1 | g12937 | g12937.t4 | cds | g12937.t4.CDS3 | 27010138 | 27010399 |
| chr_1 | g12937 | g12937.t4 | TSS | g12937.t4 | 27011325 | 27011325 |
>g12937.t4 Gene=g12937 Length=667
TATTAATACATTGAATGGAAAAGATGGTACAGGTTCTCATTTAGTTAGCGTTCCAAGAGG
ATCACAATTGCAAGAAGCATTAATTTCATCAGCAATCATTCAAGGAGAAGATGGAATGGG
CGCAGGAATTGGTGGTGCAGGCTTTGAATTTGGTGTTGATCCTAATGAGGATCCAGAACT
TGCTCTTGCTTTAAGAGTTTCAATGGAAGAACAGCGTCAGCGACAAGAAGAAGAGCAAAG
ACGTGCACAAGCAGCTTCTGCTCAAGAAACTTCAACTGAAAATGCTCCAGCTGTTTCTAC
TATTGCACCAACATCTGACGAAGCTATGCTTGAACGTGCACTCGCATTGTCGACTGAGAC
ACCGGTAAAAAGACTTCATTTTGCTAACATGACTGAAGAGGAACAAATTGCTTTTGCTAT
GCAAATGTCAATGCAAGATGCACAGGAGCCTATAACACAACAAGCAAAACGTCCAAAAAA
AGACGATACACCAATGGAAGTTGATGAAGATTATAATGAAGTAATTACTGATCCAGCATT
TCTCCAGAGTGTTTTAGAAAATCTTCCTGGTGTAGATCCGCAATCTGAGGCAATACGTGG
TGCAGTTGACTCCTTAAATAAAGACAAAAAGTCTGATAAAGATGGAAAAGGCAGCGGATC
TAAATAA
>g12937.t4 Gene=g12937 Length=183
MGAGIGGAGFEFGVDPNEDPELALALRVSMEEQRQRQEEEQRRAQAASAQETSTENAPAV
STIAPTSDEAMLERALALSTETPVKRLHFANMTEEEQIAFAMQMSMQDAQEPITQQAKRP
KKDDTPMEVDEDYNEVITDPAFLQSVLENLPGVDPQSEAIRGAVDSLNKDKKSDKDGKGS
GSK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 16 | g12937.t4 | Coils | Coil | Coil | 27 | 50 | - |
| 15 | g12937.t4 | Gene3D | G3DSA:1.10.10.890 | - | 67 | 107 | 3.1E-13 |
| 10 | g12937.t4 | MobiDBLite | mobidb-lite | consensus disorder prediction | 29 | 67 | - |
| 9 | g12937.t4 | MobiDBLite | mobidb-lite | consensus disorder prediction | 31 | 45 | - |
| 14 | g12937.t4 | MobiDBLite | mobidb-lite | consensus disorder prediction | 46 | 63 | - |
| 11 | g12937.t4 | MobiDBLite | mobidb-lite | consensus disorder prediction | 108 | 128 | - |
| 13 | g12937.t4 | MobiDBLite | mobidb-lite | consensus disorder prediction | 148 | 183 | - |
| 12 | g12937.t4 | MobiDBLite | mobidb-lite | consensus disorder prediction | 164 | 183 | - |
| 4 | g12937.t4 | PANTHER | PTHR10223:SF7 | 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 4 | 4 | 178 | 4.1E-42 |
| 5 | g12937.t4 | PANTHER | PTHR10223 | 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 4 | 4 | 178 | 4.1E-42 |
| 3 | g12937.t4 | Pfam | PF02809 | Ubiquitin interaction motif | 18 | 33 | 0.0041 |
| 2 | g12937.t4 | Pfam | PF02809 | Ubiquitin interaction motif | 67 | 81 | 0.012 |
| 1 | g12937.t4 | Pfam | PF02809 | Ubiquitin interaction motif | 93 | 109 | 8.8E-4 |
| 18 | g12937.t4 | ProSiteProfiles | PS50330 | Ubiquitin-interacting motif (UIM) domain profile. | 17 | 36 | 10.732 |
| 17 | g12937.t4 | ProSiteProfiles | PS50330 | Ubiquitin-interacting motif (UIM) domain profile. | 67 | 86 | 8.566 |
| 19 | g12937.t4 | ProSiteProfiles | PS50330 | Ubiquitin-interacting motif (UIM) domain profile. | 93 | 112 | 10.363 |
| 7 | g12937.t4 | SMART | SM00726 | uim | 17 | 36 | 0.021 |
| 6 | g12937.t4 | SMART | SM00726 | uim | 67 | 86 | 4.4 |
| 8 | g12937.t4 | SMART | SM00726 | uim | 93 | 112 | 0.025 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed