| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12937 | g12937.t6 | TTS | g12937.t6 | 27009496 | 27009496 |
| chr_1 | g12937 | g12937.t6 | isoform | g12937.t6 | 27009648 | 27010562 |
| chr_1 | g12937 | g12937.t6 | exon | g12937.t6.exon1 | 27009648 | 27009871 |
| chr_1 | g12937 | g12937.t6 | cds | g12937.t6.CDS1 | 27009648 | 27009871 |
| chr_1 | g12937 | g12937.t6 | exon | g12937.t6.exon2 | 27009934 | 27010018 |
| chr_1 | g12937 | g12937.t6 | cds | g12937.t6.CDS2 | 27009934 | 27010018 |
| chr_1 | g12937 | g12937.t6 | exon | g12937.t6.exon3 | 27010151 | 27010562 |
| chr_1 | g12937 | g12937.t6 | cds | g12937.t6.CDS3 | 27010151 | 27010399 |
| chr_1 | g12937 | g12937.t6 | TSS | g12937.t6 | 27011325 | 27011325 |
>g12937.t6 Gene=g12937 Length=721
TGTGAGCTTTGGTGACCATCAAAAAAATAATGATGTGCTTACTTCATTTATTAATACATT
GAATGGAAAAGATGGTACAGGTTCTCATTTAGTTAGCGTTCCAAGAGGATCACAATTGCA
AGAAGCATTAATTTCATCAGCAATCATTCAAGGAGAAGATGGAATGGGCGCAGGAATTGG
TGGTGCAGGCTTTGAATTTGGTGTTGATCCTAATGAGGATCCAGAACTTGCTCTTGCTTT
AAGAGTTTCAATGGAAGAACAGCGTCAGCGACAAGAAGAAGAGCAAAGACGTGCACAAGC
AGCTTCTGCTCAAGAAACTTCAACTGAAAATGCTCCAGCTGTTTCTACTATTGCACCAAC
ATCTGACGAAGCTATGCTTGAACGTGCACTCGCATTGTCGACTGAGACACCGAGTGACGA
GGCTATGCCAGATTTTGCTAACATGACTGAAGAGGAACAAATTGCTTTTGCTATGCAAAT
GTCAATGCAAGATGCACAGGAGCCTATAACACAACAAGCAAAACGTCCAAAAAAAGACGA
TACACCAATGGAAGTTGATGAAGATTATAATGAAGTAATTACTGATCCAGCATTTCTCCA
GAGTGTTTTAGAAAATCTTCCTGGTGTAGATCCGCAATCTGAGGCAATACGTGGTGCAGT
TGACTCCTTAAATAAAGACAAAAAGTCTGATAAAGATGGAAAAGGCAGCGGATCTAAATA
A
>g12937.t6 Gene=g12937 Length=185
MGAGIGGAGFEFGVDPNEDPELALALRVSMEEQRQRQEEEQRRAQAASAQETSTENAPAV
STIAPTSDEAMLERALALSTETPSDEAMPDFANMTEEEQIAFAMQMSMQDAQEPITQQAK
RPKKDDTPMEVDEDYNEVITDPAFLQSVLENLPGVDPQSEAIRGAVDSLNKDKKSDKDGK
GSGSK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 16 | g12937.t6 | Coils | Coil | Coil | 27 | 50 | - |
| 15 | g12937.t6 | Gene3D | G3DSA:1.10.10.890 | - | 67 | 109 | 2.1E-17 |
| 12 | g12937.t6 | MobiDBLite | mobidb-lite | consensus disorder prediction | 29 | 67 | - |
| 9 | g12937.t6 | MobiDBLite | mobidb-lite | consensus disorder prediction | 31 | 45 | - |
| 14 | g12937.t6 | MobiDBLite | mobidb-lite | consensus disorder prediction | 46 | 63 | - |
| 13 | g12937.t6 | MobiDBLite | mobidb-lite | consensus disorder prediction | 110 | 130 | - |
| 11 | g12937.t6 | MobiDBLite | mobidb-lite | consensus disorder prediction | 149 | 185 | - |
| 10 | g12937.t6 | MobiDBLite | mobidb-lite | consensus disorder prediction | 166 | 185 | - |
| 4 | g12937.t6 | PANTHER | PTHR10223:SF7 | 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 4 | 4 | 180 | 4.7E-44 |
| 5 | g12937.t6 | PANTHER | PTHR10223 | 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 4 | 4 | 180 | 4.7E-44 |
| 3 | g12937.t6 | Pfam | PF02809 | Ubiquitin interaction motif | 18 | 33 | 0.0042 |
| 2 | g12937.t6 | Pfam | PF02809 | Ubiquitin interaction motif | 67 | 81 | 0.013 |
| 1 | g12937.t6 | Pfam | PF02809 | Ubiquitin interaction motif | 95 | 111 | 8.9E-4 |
| 18 | g12937.t6 | ProSiteProfiles | PS50330 | Ubiquitin-interacting motif (UIM) domain profile. | 17 | 36 | 10.732 |
| 17 | g12937.t6 | ProSiteProfiles | PS50330 | Ubiquitin-interacting motif (UIM) domain profile. | 95 | 114 | 10.363 |
| 8 | g12937.t6 | SMART | SM00726 | uim | 17 | 36 | 0.021 |
| 7 | g12937.t6 | SMART | SM00726 | uim | 67 | 86 | 0.84 |
| 6 | g12937.t6 | SMART | SM00726 | uim | 95 | 114 | 0.025 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.