General information for g12944.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Fatty acid hydroxylase domain-containing protein 2.
Parent gene
- The parent gene g12944 is located on chr_1: 27090871..27091719 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12944 | g12944.t3 | TSS | g12944.t3 | 27090582 | 27090582 |
| chr_1 | g12944 | g12944.t3 | isoform | g12944.t3 | 27090871 | 27091321 |
| chr_1 | g12944 | g12944.t3 | exon | g12944.t3.exon1 | 27090871 | 27091206 |
| chr_1 | g12944 | g12944.t3 | cds | g12944.t3.CDS1 | 27090871 | 27091206 |
| chr_1 | g12944 | g12944.t3 | exon | g12944.t3.exon2 | 27091317 | 27091321 |
| chr_1 | g12944 | g12944.t3 | cds | g12944.t3.CDS2 | 27091317 | 27091319 |
| chr_1 | g12944 | g12944.t3 | TTS | g12944.t3 | NA | NA |
Sequences
>g12944.t3 Gene=g12944 Length=341
ATGTTGAGGAAATATAAAATACAAGAAGGTGCAAATGAACCTGTAGATTTATCAATGGTT
TGGTACACTATCAAAACTGTAGTCTTCAATCAAGTTTTCATTAGTGGAGCAACACTTTAC
ATCTCATATTTAATTAGAATGACAAAAGAAAATGCAAATGATTCACTCAAAATTACACCA
AGCTTCTCAAAAGTTGCAATGGATTTGATCATTTGTTACTTTGTTGATGAAGTGTTATTC
TATTATGGTCATCGACTTAGTCATACCAAATACTTGTATAAAAAAGTTCATAAACAACAT
CATGATTATACTGCGCCAATTGCTATTGCTGCAATGCATTC
>g12944.t3 Gene=g12944 Length=113
MLRKYKIQEGANEPVDLSMVWYTIKTVVFNQVFISGATLYISYLIRMTKENANDSLKITP
SFSKVAMDLIICYFVDEVLFYYGHRLSHTKYLYKKVHKQHHDYTAPIAIAAMH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g12944.t3 | PANTHER | PTHR11863:SF26 | FATTY ACID HYDROXYLASE DOMAIN-CONTAINING PROTEIN 2 | 2 | 112 | 4.0E-25 |
| 3 | g12944.t3 | PANTHER | PTHR11863 | STEROL DESATURASE | 2 | 112 | 4.0E-25 |
| 1 | g12944.t3 | Pfam | PF04116 | Fatty acid hydroxylase superfamily | 70 | 112 | 7.1E-8 |
| 8 | g12944.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
| 10 | g12944.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 45 | - |
| 6 | g12944.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 46 | 64 | - |
| 9 | g12944.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 65 | 83 | - |
| 7 | g12944.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 84 | 113 | - |
| 4 | g12944.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 26 | 45 | - |
| 5 | g12944.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 65 | 84 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005506 | iron ion binding | MF |
| GO:0055114 | NA | NA |
| GO:0016491 | oxidoreductase activity | MF |
| GO:0008610 | lipid biosynthetic process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed