| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12945 | g12945.t9 | isoform | g12945.t9 | 27093185 | 27093986 |
| chr_1 | g12945 | g12945.t9 | exon | g12945.t9.exon1 | 27093185 | 27093466 |
| chr_1 | g12945 | g12945.t9 | cds | g12945.t9.CDS1 | 27093185 | 27093466 |
| chr_1 | g12945 | g12945.t9 | exon | g12945.t9.exon2 | 27093527 | 27093662 |
| chr_1 | g12945 | g12945.t9 | cds | g12945.t9.CDS2 | 27093527 | 27093662 |
| chr_1 | g12945 | g12945.t9 | exon | g12945.t9.exon3 | 27093819 | 27093986 |
| chr_1 | g12945 | g12945.t9 | cds | g12945.t9.CDS3 | 27093819 | 27093835 |
| chr_1 | g12945 | g12945.t9 | TTS | g12945.t9 | 27094207 | 27094207 |
| chr_1 | g12945 | g12945.t9 | TSS | g12945.t9 | NA | NA |
>g12945.t9 Gene=g12945 Length=586
ATGGTTTGGTACACTATCAAAACTGTAGTCTTCAATCAAGTTTTCATTAGTGGAGCAACA
CTTTACATCTCATATTTAATTAGAATGACAAAAGAAAATGTAAATGAGTCACTCAAAATT
ACACCAAGCTTCTCAAAAGTTGCAATGGATTTGATCATTTGCTTCTTTGTTGATGAAGTG
TTATTCTATTATGGTCATCGACTCGGGCACACTAAATACTTGTATAAAAAAGTTCACAAA
CAACATCACGATTATACTGCACCAATAGCTATTGCAGCATTACACTCAAGTCCAATTGAT
CATGTTCTTGCCAATATTCTACCAGTAGCACTTGGACCTATGATTACAAATAGTCACATT
AGTACAGCTTGGATTTGGTATATTGTTACTCAATTATTCGCTCTAAACAACCATTCAGTT
TCTTTTTATGAATAGGTTTGTCGAATGCTTTGGAAAAATGGGTCTACTTGATCGTCTTCA
TGGCACTGACAAAACTTTCCAAAAGACAATGCAAGGCATCAGACATCGCGTTCTATTCAC
AACAAAATCAGCACGAGAAATTTTTCCTGATAAGAAAGACAATTAA
>g12945.t9 Gene=g12945 Length=144
MVWYTIKTVVFNQVFISGATLYISYLIRMTKENVNESLKITPSFSKVAMDLIICFFVDEV
LFYYGHRLGHTKYLYKKVHKQHHDYTAPIAIAALHSSPIDHVLANILPVALGPMITNSHI
STAWIWYIVTQLFALNNHSVSFYE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g12945.t9 | PANTHER | PTHR11863:SF26 | FATTY ACID HYDROXYLASE DOMAIN-CONTAINING PROTEIN 2 | 3 | 139 | 1.1E-38 |
| 3 | g12945.t9 | PANTHER | PTHR11863 | STEROL DESATURASE | 3 | 139 | 1.1E-38 |
| 1 | g12945.t9 | Pfam | PF04116 | Fatty acid hydroxylase superfamily | 52 | 140 | 9.8E-16 |
| 7 | g12945.t9 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 8 | - |
| 9 | g12945.t9 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 9 | 27 | - |
| 8 | g12945.t9 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 28 | 46 | - |
| 10 | g12945.t9 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 47 | 65 | - |
| 6 | g12945.t9 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 66 | 144 | - |
| 5 | g12945.t9 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 9 | 27 | - |
| 4 | g12945.t9 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 47 | 66 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005506 | iron ion binding | MF |
| GO:0055114 | NA | NA |
| GO:0016491 | oxidoreductase activity | MF |
| GO:0008610 | lipid biosynthetic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed