| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12947 | g12947.t15 | TTS | g12947.t15 | 27097147 | 27097147 |
| chr_1 | g12947 | g12947.t15 | isoform | g12947.t15 | 27097767 | 27098516 |
| chr_1 | g12947 | g12947.t15 | exon | g12947.t15.exon1 | 27097767 | 27098183 |
| chr_1 | g12947 | g12947.t15 | cds | g12947.t15.CDS1 | 27097768 | 27098183 |
| chr_1 | g12947 | g12947.t15 | exon | g12947.t15.exon2 | 27098304 | 27098374 |
| chr_1 | g12947 | g12947.t15 | cds | g12947.t15.CDS2 | 27098304 | 27098374 |
| chr_1 | g12947 | g12947.t15 | exon | g12947.t15.exon3 | 27098434 | 27098516 |
| chr_1 | g12947 | g12947.t15 | cds | g12947.t15.CDS3 | 27098434 | 27098516 |
| chr_1 | g12947 | g12947.t15 | TSS | g12947.t15 | 27098545 | 27098545 |
>g12947.t15 Gene=g12947 Length=571
ATGGATCTTAAAAATAGTCTTACAAGTTTTGATATTTTTCATCCATTGACATATTATATT
CCAATTATATATTTTATAACAAGAGTTTTGGAAAATTTTACAAACACAAGTAATTTTTGG
ACAAAAGTTTGGAATAAAATTGTCGATATTAACGATGACGACTACACTTTTAAACTATAT
GGCACAATTATTTATACCAGTTTAATTTATTGGATTGTTGGTTTGTTATATTTTTCAATG
GACGTAACACAGAAACCAAAATCTTTTCGTAAATATAAGACACAACCTGATGCAAATGAA
CCTCTTGATTATAAGAAAATTTTGTTGGCTTTACCTCTTGTACTTTTCAACCAACTTATA
CTTAATCCCATAGTAACATGTATTTTTGTGACAATTGGAAGGAAAACTTTATCAAGTGCT
CATATTCGCTACACAACAAGTTTTCAACAATTGATGATCGATATTATCGTGTATCAATTA
ATTTATGAAGCATGCTTTTATTATGCTCATCGATTATTTCACCATAAATATTTCTATGCA
AAAATTCACAAAGTTCATCATAAATTTACAG
>g12947.t15 Gene=g12947 Length=190
MDLKNSLTSFDIFHPLTYYIPIIYFITRVLENFTNTSNFWTKVWNKIVDINDDDYTFKLY
GTIIYTSLIYWIVGLLYFSMDVTQKPKSFRKYKTQPDANEPLDYKKILLALPLVLFNQLI
LNPIVTCIFVTIGRKTLSSAHIRYTTSFQQLMIDIIVYQLIYEACFYYAHRLFHHKYFYA
KIHKVHHKFT
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g12947.t15 | PANTHER | PTHR11863:SF26 | FATTY ACID HYDROXYLASE DOMAIN-CONTAINING PROTEIN 2 | 30 | 190 | 6.1E-27 |
| 2 | g12947.t15 | PANTHER | PTHR11863 | STEROL DESATURASE | 30 | 190 | 6.1E-27 |
| 7 | g12947.t15 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 15 | g12947.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 30 | - |
| 10 | g12947.t15 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 31 | 58 | - |
| 14 | g12947.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 59 | 80 | - |
| 8 | g12947.t15 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 81 | 106 | - |
| 13 | g12947.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 107 | 131 | - |
| 11 | g12947.t15 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 132 | 150 | - |
| 12 | g12947.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 151 | 169 | - |
| 9 | g12947.t15 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 170 | 190 | - |
| 4 | g12947.t15 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 30 | - |
| 5 | g12947.t15 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 59 | 78 | - |
| 3 | g12947.t15 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 111 | 133 | - |
| 6 | g12947.t15 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 148 | 170 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed