| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12948 | g12948.t3 | TTS | g12948.t3 | 27099013 | 27099013 |
| chr_1 | g12948 | g12948.t3 | isoform | g12948.t3 | 27099340 | 27100151 |
| chr_1 | g12948 | g12948.t3 | exon | g12948.t3.exon1 | 27099340 | 27099882 |
| chr_1 | g12948 | g12948.t3 | cds | g12948.t3.CDS1 | 27099341 | 27099882 |
| chr_1 | g12948 | g12948.t3 | exon | g12948.t3.exon2 | 27099947 | 27100017 |
| chr_1 | g12948 | g12948.t3 | cds | g12948.t3.CDS2 | 27099947 | 27100017 |
| chr_1 | g12948 | g12948.t3 | exon | g12948.t3.exon3 | 27100072 | 27100151 |
| chr_1 | g12948 | g12948.t3 | cds | g12948.t3.CDS3 | 27100072 | 27100151 |
| chr_1 | g12948 | g12948.t3 | TSS | g12948.t3 | 27100182 | 27100182 |
>g12948.t3 Gene=g12948 Length=694
ATGGAAGCAAAAAAGCGACCGTATTTTCTCGATATTAATCCATTCATGTTATGGGTTGCT
GTTATTTATGGATTCACAAGAATTATTGAAATCTTGACAGGTAGCGAGAATTTTTGGAGT
AACTTTTGGAATAGAATTGTTGATCTTTGCGATGACGAATATTATTTCAAAGTCATTCTC
ACAATGGCGTACACAACAATTCTCTATTGGGGTGTCGGAATGTTATTCATTATTATGGAC
ATTACAAATCCAAAGTTTATCCAAAAGTACAAAACACAACCTGAAGCCCATCTTCCACTT
GACATGAAGAAATTTTTACCTGCATGTCGTGTTGTGCTTTTCAATCAATTTGTATTAAAT
GTTTTAGTTTCACATGTTTTGACTATAATTGAAAAAAACTTGGAACGTCCTGGACTTCGA
ACAACACCAACTTTCTATCAGTTGATGGTAGATTTATTTTTATATCAATTCATTTATGAA
TTTGCATTCTTCTATACACATCGTTTGCTACACACGAAATATCTTTACAAAAAAATTCAC
AAAATTCATCATCAATGGCAAGCGCCAGTTTCGATAATGGCAACTTATGCACATCCAATT
GAACACATTTTTAGTAATCTTTTTCCTGTATTTCTTGGAATAGGTTTATTAAAATCGCCA
ATGTCAACAGGATGGGTTATAATGTCTTTGACAA
>g12948.t3 Gene=g12948 Length=231
MEAKKRPYFLDINPFMLWVAVIYGFTRIIEILTGSENFWSNFWNRIVDLCDDEYYFKVIL
TMAYTTILYWGVGMLFIIMDITNPKFIQKYKTQPEAHLPLDMKKFLPACRVVLFNQFVLN
VLVSHVLTIIEKNLERPGLRTTPTFYQLMVDLFLYQFIYEFAFFYTHRLLHTKYLYKKIH
KIHHQWQAPVSIMATYAHPIEHIFSNLFPVFLGIGLLKSPMSTGWVIMSLT
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g12948.t3 | PANTHER | PTHR11863:SF26 | FATTY ACID HYDROXYLASE DOMAIN-CONTAINING PROTEIN 2 | 29 | 230 | 4.6E-45 |
| 3 | g12948.t3 | PANTHER | PTHR11863 | STEROL DESATURASE | 29 | 230 | 4.6E-45 |
| 1 | g12948.t3 | Pfam | PF04116 | Fatty acid hydroxylase superfamily | 153 | 229 | 2.3E-12 |
| 8 | g12948.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 15 | g12948.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
| 12 | g12948.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 35 | 53 | - |
| 16 | g12948.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 79 | - |
| 10 | g12948.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 80 | 110 | - |
| 14 | g12948.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 111 | 130 | - |
| 11 | g12948.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 131 | 144 | - |
| 13 | g12948.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 145 | 165 | - |
| 9 | g12948.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 166 | 231 | - |
| 4 | g12948.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 29 | - |
| 7 | g12948.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 59 | 81 | - |
| 6 | g12948.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 111 | 130 | - |
| 5 | g12948.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 145 | 167 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005506 | iron ion binding | MF |
| GO:0055114 | NA | NA |
| GO:0016491 | oxidoreductase activity | MF |
| GO:0008610 | lipid biosynthetic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.