| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12995 | g12995.t1 | TSS | g12995.t1 | 27391830 | 27391830 |
| chr_1 | g12995 | g12995.t1 | isoform | g12995.t1 | 27391847 | 27392260 |
| chr_1 | g12995 | g12995.t1 | exon | g12995.t1.exon1 | 27391847 | 27391849 |
| chr_1 | g12995 | g12995.t1 | cds | g12995.t1.CDS1 | 27391847 | 27391849 |
| chr_1 | g12995 | g12995.t1 | exon | g12995.t1.exon2 | 27391917 | 27392052 |
| chr_1 | g12995 | g12995.t1 | cds | g12995.t1.CDS2 | 27391917 | 27392052 |
| chr_1 | g12995 | g12995.t1 | exon | g12995.t1.exon3 | 27392124 | 27392260 |
| chr_1 | g12995 | g12995.t1 | cds | g12995.t1.CDS3 | 27392124 | 27392260 |
| chr_1 | g12995 | g12995.t1 | TTS | g12995.t1 | 27392342 | 27392342 |
>g12995.t1 Gene=g12995 Length=276
ATGACCAAAGGTACATCAAGCTTTGGTAAGCGCCGTAATAAGACGCACACACTTTGTCGT
CGATGCGGTCGCTCATCATACCACATTCAAAAATCGACATGCGCCCAATGCGGCTATCCT
GCTGCAAAGACTAGATCATACAACTGGTCTATTAAGGCTAAGCGAAGAAAGACCACTGGT
ACAGGCAGATGCCGTTACTTGAAAGTTGTTCGTCGTAAGTTCCGCAATGGATTCAGAGAA
GGAACAACAGCAAAGCCACGCAAGACTAAGGCATAA
>g12995.t1 Gene=g12995 Length=91
MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKTRSYNWSIKAKRRKTTG
TGRCRYLKVVRRKFRNGFREGTTAKPRKTKA
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g12995.t1 | Gene3D | G3DSA:2.20.25.30 | - | 1 | 88 | 9.1E-46 |
| 3 | g12995.t1 | Hamap | MF_00547 | 50S ribosomal protein L37e [rpl37e]. | 2 | 53 | 16.450375 |
| 2 | g12995.t1 | PANTHER | PTHR10768 | 60S RIBOSOMAL PROTEIN L37 | 1 | 90 | 9.4E-42 |
| 1 | g12995.t1 | Pfam | PF01907 | Ribosomal protein L37e | 2 | 54 | 7.9E-28 |
| 5 | g12995.t1 | ProSitePatterns | PS01077 | Ribosomal protein L37e signature. | 4 | 23 | - |
| 4 | g12995.t1 | SUPERFAMILY | SSF57829 | Zn-binding ribosomal proteins | 1 | 55 | 4.58E-25 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.