| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12997 | g12997.t1 | TTS | g12997.t1 | 27404752 | 27404752 |
| chr_1 | g12997 | g12997.t1 | isoform | g12997.t1 | 27404895 | 27405256 |
| chr_1 | g12997 | g12997.t1 | exon | g12997.t1.exon1 | 27404895 | 27404974 |
| chr_1 | g12997 | g12997.t1 | cds | g12997.t1.CDS1 | 27404895 | 27404974 |
| chr_1 | g12997 | g12997.t1 | exon | g12997.t1.exon2 | 27405050 | 27405185 |
| chr_1 | g12997 | g12997.t1 | cds | g12997.t1.CDS2 | 27405050 | 27405185 |
| chr_1 | g12997 | g12997.t1 | exon | g12997.t1.exon3 | 27405254 | 27405256 |
| chr_1 | g12997 | g12997.t1 | cds | g12997.t1.CDS3 | 27405254 | 27405256 |
| chr_1 | g12997 | g12997.t1 | TSS | g12997.t1 | 27405577 | 27405577 |
>g12997.t1 Gene=g12997 Length=219
ATGACCCAAGGTACATCAAGCTTTGTAAGCGCCGTAATAAGACGCCACACACTTTGTCGT
CGATGCGTTCGCTCATCATACCACATTCAAAAATCGACATGCGCCAATGCGGCCTATCCT
GCTGCAAAGACTAGATCATACAACTGGTCTATTAAGGCTAAGCGAAGAAAGACCACTGGT
ACAGGCAGATGCCGTTACTTGAAAGTTTGTTCGTCGTAA
>g12997.t1 Gene=g12997 Length=72
MTQGTSSFVSAVIRRHTLCRRCVRSSYHIQKSTCANAAYPAAKTRSYNWSIKAKRRKTTG
TGRCRYLKVCSS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g12997.t1 | Gene3D | G3DSA:2.20.25.30 | - | 1 | 72 | 5.5E-30 |
| 2 | g12997.t1 | PANTHER | PTHR10768 | 60S RIBOSOMAL PROTEIN L37 | 1 | 69 | 1.0E-24 |
| 1 | g12997.t1 | Pfam | PF01907 | Ribosomal protein L37e | 2 | 54 | 2.9E-19 |
| 3 | g12997.t1 | SUPERFAMILY | SSF57829 | Zn-binding ribosomal proteins | 1 | 55 | 6.96E-18 |
| 4 | g12997.t1 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 37 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed