| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13169 | g13169.t15 | TSS | g13169.t15 | 28316629 | 28316629 |
| chr_1 | g13169 | g13169.t15 | isoform | g13169.t15 | 28316740 | 28317634 |
| chr_1 | g13169 | g13169.t15 | exon | g13169.t15.exon1 | 28316740 | 28316755 |
| chr_1 | g13169 | g13169.t15 | cds | g13169.t15.CDS1 | 28316740 | 28316755 |
| chr_1 | g13169 | g13169.t15 | exon | g13169.t15.exon2 | 28316833 | 28316883 |
| chr_1 | g13169 | g13169.t15 | cds | g13169.t15.CDS2 | 28316833 | 28316883 |
| chr_1 | g13169 | g13169.t15 | exon | g13169.t15.exon3 | 28316964 | 28317310 |
| chr_1 | g13169 | g13169.t15 | cds | g13169.t15.CDS3 | 28316964 | 28317310 |
| chr_1 | g13169 | g13169.t15 | exon | g13169.t15.exon4 | 28317377 | 28317634 |
| chr_1 | g13169 | g13169.t15 | cds | g13169.t15.CDS4 | 28317377 | 28317634 |
| chr_1 | g13169 | g13169.t15 | TTS | g13169.t15 | 28317861 | 28317861 |
>g13169.t15 Gene=g13169 Length=672
ATGTCTCTTACTTGGACTGGATTTTTGTATGCTGAAGTTGCTGTTGTTCTTTTATTAGTA
TTGCCTGTCTTTAGTGCATCCAAATGGAATCGTTTCTTCAAATCAAGATTTCTGTCAGCT
CTCTCTCGGCAAGCACAGATTTACTTTTATTTGATGCTTGGTGTTTTGGTAATCTTTTTG
CTTGAGGCTATTAGAGAAATGCGTAAATACAGCAGCAGTGAAGAGGAAACTACTCTTAAT
TTGGGAATGCAACATTCAATGAGACTCTTCCGTGCTCAACGCAACTTTTACATCTCTGGG
TTTGCCATTTTCTTGTCATTGGTCATTAGACGATTGATTATTTTAATCACAACACAAGCA
TCGTTAATTGCAAATTCTGAAGCAAGCATGAAACAAGCACAGTCCGCAACACAGGCTGCT
CGTCATTTAATGGCCGAAAAGAAAACTGATGGTGGTTCTGCTAACACTGCTAATAGTGAT
AATAAAGCTGATGATGATAAGGAAAAATTACAAAACAAGATTAAAGAATTGGAAGCTGAA
TTGAAAAAGGAACGAAAGGATAAAGAAGCATTAAAATCGCAAGCTGATTCACTCAACAGA
GAATATGATCGATTGACAGAAGAGTACAGCAAATTGCAGAACAAGCAGGCTGCTGGTGAC
AAGTCAGACTAA
>g13169.t15 Gene=g13169 Length=223
MSLTWTGFLYAEVAVVLLLVLPVFSASKWNRFFKSRFLSALSRQAQIYFYLMLGVLVIFL
LEAIREMRKYSSSEEETTLNLGMQHSMRLFRAQRNFYISGFAIFLSLVIRRLIILITTQA
SLIANSEASMKQAQSATQAARHLMAEKKTDGGSANTANSDNKADDDKEKLQNKIKELEAE
LKKERKDKEALKSQADSLNREYDRLTEEYSKLQNKQAAGDKSD
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g13169.t15 | Coils | Coil | Coil | 160 | 215 | - |
| 9 | g13169.t15 | Gene3D | G3DSA:1.20.5.110 | - | 153 | 212 | 1.4E-5 |
| 8 | g13169.t15 | MobiDBLite | mobidb-lite | consensus disorder prediction | 134 | 171 | - |
| 3 | g13169.t15 | PANTHER | PTHR12701:SF50 | LP10861P | 1 | 217 | 4.0E-71 |
| 4 | g13169.t15 | PANTHER | PTHR12701 | BCR-ASSOCIATED PROTEIN, BAP | 1 | 217 | 4.0E-71 |
| 2 | g13169.t15 | Pfam | PF05529 | Bap31/Bap29 transmembrane region | 1 | 128 | 6.0E-37 |
| 1 | g13169.t15 | Pfam | PF18035 | Bap31/Bap29 cytoplasmic coiled-coil domain | 172 | 223 | 9.2E-18 |
| 11 | g13169.t15 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 6 | - |
| 17 | g13169.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 27 | - |
| 13 | g13169.t15 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 28 | 46 | - |
| 15 | g13169.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 47 | 64 | - |
| 12 | g13169.t15 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 65 | 95 | - |
| 16 | g13169.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 96 | 116 | - |
| 14 | g13169.t15 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 117 | 223 | - |
| 5 | g13169.t15 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 29 | - |
| 7 | g13169.t15 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 44 | 61 | - |
| 6 | g13169.t15 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 114 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006886 | intracellular protein transport | BP |
| GO:0005783 | endoplasmic reticulum | CC |
| GO:0016021 | integral component of membrane | CC |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed